Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
Nintendo Switch Skins
Nintendo Switch Skins
Nintendo Switch Skin's Store Nintendo Switch Skin's Store 2 Nintendo Switch Skin's Store 3 Nintendo Switch Skin's Store 4 Nintendo Switch Skin's Store 5
Pikmin 4 decal skin for Nintendo Switch Console and Contro..
Pikmin 4 decal skin for Nintendo Switch Console and Contro..
$22.00
Pikmin 4 decal skin for Nintendo Switch Console and Contro..
Pikmin 4 decal skin for Nintendo Switch Console and Contro..
$22.00
Pikmin 4 decal skin for Nintendo Switch Console and Contro..
Pikmin 4 decal skin for Nintendo Switch Console and Contro..
$22.00
Pikmin 4 decal skin for Nintendo Switch Console and Contro..
Pikmin 4 decal skin for Nintendo Switch Console and Contro..
$22.00
Pikmin 4 decal skin for Nintendo Switch Console and Contro..
Pikmin 4 decal skin for Nintendo Switch Console and Contro..
$22.00
Zelda Tears of the Kingdom decal skin for Nintendo Switch ..
Zelda Tears of the Kingdom decal skin for Nintendo Switch ..
$22.00
Zelda Tears of the Kingdom decal skin for Nintendo Switch ..
Zelda Tears of the Kingdom decal skin for Nintendo Switch ..
$22.00
Zelda Tears of the Kingdom decal skin for Nintendo Switch ..
Zelda Tears of the Kingdom decal skin for Nintendo Switch ..
$22.00
Zelda Tears of the Kingdom decal skin for Nintendo Switch ..
Zelda Tears of the Kingdom decal skin for Nintendo Switch ..
$22.00
Zelda Tears of the Kingdom decal skin for Nintendo Switch ..
Zelda Tears of the Kingdom decal skin for Nintendo Switch ..
$22.00
Zelda Tears of the Kingdom decal skin for Nintendo Switch ..
Zelda Tears of the Kingdom decal skin for Nintendo Switch ..
$22.00
Zelda Tears of the Kingdom decal skin for Nintendo Switch ..
Zelda Tears of the Kingdom decal skin for Nintendo Switch ..
$22.00
Zelda Tears of the Kingdom decal skin for Nintendo Switch ..
Zelda Tears of the Kingdom decal skin for Nintendo Switch ..
$22.00
Zelda Tears of the Kingdom decal skin for Nintendo Switch ..
Zelda Tears of the Kingdom decal skin for Nintendo Switch ..
$22.00
Zelda Tears of the Kingdom decal skin for Nintendo Switch ..
Zelda Tears of the Kingdom decal skin for Nintendo Switch ..
$22.00
Cute Unicorn decal skin for Nintendo Switch Console and Co..
Cute Unicorn decal skin for Nintendo Switch Console and Co..
$22.00
Ironman decal skin for Nintendo Switch Console and Control..
Ironman decal skin for Nintendo Switch Console and Control..
$22.00
Spider Man decal skin for Nintendo Switch Console and Cont..
Spider Man decal skin for Nintendo Switch Console and Cont..
$22.00
Hatsune Miku decal skin for Nintendo Switch Console and Co..
Hatsune Miku decal skin for Nintendo Switch Console and Co..
$22.00
Shin Megami Tensei Persona decal skin for Nintendo Switch ..
Shin Megami Tensei Persona decal skin for Nintendo Switch ..
$22.00
Monster Hunter decal skin for Nintendo Switch Console and ..
Monster Hunter decal skin for Nintendo Switch Console and ..
$22.00
A Nightmare on Elm Street decal skin for Nintendo Switch C..
A Nightmare on Elm Street decal skin for Nintendo Switch C..
$22.00
Diablo decal skin for Nintendo Switch Console and Controll..
Diablo decal skin for Nintendo Switch Console and Controll..
$22.00
Fortnite decal skin for Nintendo Switch Console and Contro..
Fortnite decal skin for Nintendo Switch Console and Contro..
$22.00
Pokemon X and Y decal skin for Nintendo Switch Console and..
Pokemon X and Y decal skin for Nintendo Switch Console and..
$22.00
Fortnie decal skin for Nintendo Switch Console and Control..
Fortnie decal skin for Nintendo Switch Console and Control..
$22.00
Fortnite decal skin for Nintendo Switch Console and Contro..
Fortnite decal skin for Nintendo Switch Console and Contro..
$22.00
Xenoblade Chronicles decal skin for Nintendo Switch Consol..
Xenoblade Chronicles decal skin for Nintendo Switch Consol..
$22.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i