Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
Nintendo Switch Skin's Store
Tree trunk decal skin for Nintendo Switch Console and Cont..
Tree trunk decal skin for Nintendo Switch Console and Cont..
$22.00
Wooden board decal skin for Nintendo Switch Console and Co..
Wooden board decal skin for Nintendo Switch Console and Co..
$22.00
Planet and land decal skin for Nintendo Switch Console and..
Planet and land decal skin for Nintendo Switch Console and..
$22.00
Space scene decal skin for Nintendo Switch Console and Con..
Space scene decal skin for Nintendo Switch Console and Con..
$22.00
Square block decal skin for Nintendo Switch Console and Co..
Square block decal skin for Nintendo Switch Console and Co..
$22.00
Wood slide board decal skin for Nintendo Switch Console an..
Wood slide board decal skin for Nintendo Switch Console an..
$22.00
Guardians of the galaxy decal skin for Nintendo Switch Con..
Guardians of the galaxy decal skin for Nintendo Switch Con..
$22.00
Guardians of the galaxy decal skin for Nintendo Switch Con..
Guardians of the galaxy decal skin for Nintendo Switch Con..
$22.00
Guardians of the galaxy decal skin for Nintendo Switch Con..
Guardians of the galaxy decal skin for Nintendo Switch Con..
$22.00
Guardians of the galaxy decal skin for Nintendo Switch Con..
Guardians of the galaxy decal skin for Nintendo Switch Con..
$22.00
Guardians of the galaxy decal skin for Nintendo Switch Con..
Guardians of the galaxy decal skin for Nintendo Switch Con..
$22.00
Guardians of the galaxy decal skin for Nintendo Switch Con..
Guardians of the galaxy decal skin for Nintendo Switch Con..
$22.00
Guardians of the galaxy decal skin for Nintendo Switch Con..
Guardians of the galaxy decal skin for Nintendo Switch Con..
$22.00
Smoke storm decal skin for Nintendo Switch Console and Con..
Smoke storm decal skin for Nintendo Switch Console and Con..
$22.00
Sun sets scene decal skin for Nintendo Switch Console and ..
Sun sets scene decal skin for Nintendo Switch Console and ..
$22.00
Flying bird decal skin for Nintendo Switch Console and Con..
Flying bird decal skin for Nintendo Switch Console and Con..
$22.00
Black galaxy decal skin for Nintendo Switch Console and Co..
Black galaxy decal skin for Nintendo Switch Console and Co..
$22.00
Carbon fiber board decal skin for Nintendo Switch Console ..
Carbon fiber board decal skin for Nintendo Switch Console ..
$22.00
Space scene decal skin for Nintendo Switch Console and Con..
Space scene decal skin for Nintendo Switch Console and Con..
$22.00
Blurry wall decal skin for Nintendo Switch Console and Con..
Blurry wall decal skin for Nintendo Switch Console and Con..
$22.00
Blue vintage decal skin for Nintendo Switch Console and Co..
Blue vintage decal skin for Nintendo Switch Console and Co..
$22.00
Wood slide board decal skin for Nintendo Switch Console an..
Wood slide board decal skin for Nintendo Switch Console an..
$22.00
Wooden board decal skin for Nintendo Switch Console and Co..
Wooden board decal skin for Nintendo Switch Console and Co..
$22.00
Pirtates of the caribean decal skin for Nintendo Switch Co..
Pirtates of the caribean decal skin for Nintendo Switch Co..
$22.00
Pirtates of the caribean decal skin for Nintendo Switch Co..
Pirtates of the caribean decal skin for Nintendo Switch Co..
$22.00
Wooden board decal skin for Nintendo Switch Console and Co..
Wooden board decal skin for Nintendo Switch Console and Co..
$22.00
Wooden board decal skin for Nintendo Switch Console and Co..
Wooden board decal skin for Nintendo Switch Console and Co..
$22.00
Wooden board decal skin for Nintendo Switch Console and Co..
Wooden board decal skin for Nintendo Switch Console and Co..
$22.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i