Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
Nintendo Switch Skin's Store 4
The Mandalorian decal skin for Nintendo Switch Console and..
The Mandalorian decal skin for Nintendo Switch Console and..
$22.00
The Mandalorian decal skin for Nintendo Switch Console and..
The Mandalorian decal skin for Nintendo Switch Console and..
$22.00
The Mandalorian decal skin for Nintendo Switch Console and..
The Mandalorian decal skin for Nintendo Switch Console and..
$22.00
The Mandalorian decal skin for Nintendo Switch Console and..
The Mandalorian decal skin for Nintendo Switch Console and..
$22.00
The Mandalorian decal skin for Nintendo Switch Console and..
The Mandalorian decal skin for Nintendo Switch Console and..
$22.00
The Punisher decal skin for Nintendo Switch Console and Co..
The Punisher decal skin for Nintendo Switch Console and Co..
$22.00
The Punisher decal skin for Nintendo Switch Console and Co..
The Punisher decal skin for Nintendo Switch Console and Co..
$22.00
The Punisher decal skin for Nintendo Switch Console and Co..
The Punisher decal skin for Nintendo Switch Console and Co..
$22.00
The Punisher decal skin for Nintendo Switch Console and Co..
The Punisher decal skin for Nintendo Switch Console and Co..
$22.00
The Punisher decal skin for Nintendo Switch Console and Co..
The Punisher decal skin for Nintendo Switch Console and Co..
$22.00
The Secret World of Arrietty decal skin for Nintendo Switc..
The Secret World of Arrietty decal skin for Nintendo Switc..
$22.00
The Witcher decal skin for Nintendo Switch Console and Con..
The Witcher decal skin for Nintendo Switch Console and Con..
$22.00
The Witcher decal skin for Nintendo Switch Console and Con..
The Witcher decal skin for Nintendo Switch Console and Con..
$22.00
The Witcher wild Hunt 3 decal skin for Nintendo Switch Con..
The Witcher wild Hunt 3 decal skin for Nintendo Switch Con..
$22.00
The Witcher wild Hunt 3 decal skin for Nintendo Switch Con..
The Witcher wild Hunt 3 decal skin for Nintendo Switch Con..
$22.00
The Witcher wild Hunt 3 decal skin for Nintendo Switch Con..
The Witcher wild Hunt 3 decal skin for Nintendo Switch Con..
$22.00
The Witcher wild Hunt 3 decal skin for Nintendo Switch Con..
The Witcher wild Hunt 3 decal skin for Nintendo Switch Con..
$22.00
The Witcher wild Hunt decal skin for Nintendo Switch Conso..
The Witcher wild Hunt decal skin for Nintendo Switch Conso..
$22.00
Tiger decal skin for Nintendo Switch Console and Controllers
Tiger decal skin for Nintendo Switch Console and Controllers
$22.00
Tokyo Ghoul decal skin for Nintendo Switch Console and Con..
Tokyo Ghoul decal skin for Nintendo Switch Console and Con..
$22.00
Tokyo Ghoul decal skin for Nintendo Switch Console and Con..
Tokyo Ghoul decal skin for Nintendo Switch Console and Con..
$22.00
Tokyo Ghoul decal skin for Nintendo Switch Console and Con..
Tokyo Ghoul decal skin for Nintendo Switch Console and Con..
$22.00
Tokyo Ghoul decal skin for Nintendo Switch Console and Con..
Tokyo Ghoul decal skin for Nintendo Switch Console and Con..
$22.00
Tokyo Ghoul decal skin for Nintendo Switch Console and Con..
Tokyo Ghoul decal skin for Nintendo Switch Console and Con..
$22.00
Tokyo Ghoul decal skin for Nintendo Switch Console and Con..
Tokyo Ghoul decal skin for Nintendo Switch Console and Con..
$22.00
Tokyo Ghoul decal skin for Nintendo Switch Console and Con..
Tokyo Ghoul decal skin for Nintendo Switch Console and Con..
$22.00
Tokyo Ghoul decal skin for Nintendo Switch Console and Con..
Tokyo Ghoul decal skin for Nintendo Switch Console and Con..
$22.00
Tokyo Ghoul decal skin for Nintendo Switch Console and Con..
Tokyo Ghoul decal skin for Nintendo Switch Console and Con..
$22.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i