Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
Nintendo Switch Skin's Store 5
Sumikko Gurashi decal skin for Nintendo Switch Console and..
Sumikko Gurashi decal skin for Nintendo Switch Console and..
$22.00
Sumikko Gurashi decal skin for Nintendo Switch Console and..
Sumikko Gurashi decal skin for Nintendo Switch Console and..
$22.00
Sumikko Gurashi decal skin for Nintendo Switch Console and..
Sumikko Gurashi decal skin for Nintendo Switch Console and..
$22.00
Sumikko Gurashi decal skin for Nintendo Switch Console and..
Sumikko Gurashi decal skin for Nintendo Switch Console and..
$22.00
Sumikko Gurashi decal skin for Nintendo Switch Console and..
Sumikko Gurashi decal skin for Nintendo Switch Console and..
$22.00
Stormtrooper decal skin for Nintendo Switch Console and Co..
Stormtrooper decal skin for Nintendo Switch Console and Co..
$22.00
Stormtrooper decal skin for Nintendo Switch Console and Co..
Stormtrooper decal skin for Nintendo Switch Console and Co..
$22.00
Stormtrooper decal skin for Nintendo Switch Console and Co..
Stormtrooper decal skin for Nintendo Switch Console and Co..
$22.00
Stormtrooper decal skin for Nintendo Switch Console and Co..
Stormtrooper decal skin for Nintendo Switch Console and Co..
$22.00
Stormtrooper decal skin for Nintendo Switch Console and Co..
Stormtrooper decal skin for Nintendo Switch Console and Co..
$22.00
Stormtrooper decal skin for Nintendo Switch Console and Co..
Stormtrooper decal skin for Nintendo Switch Console and Co..
$22.00
Starry sky neutral decal skin for Nintendo Switch Console ..
Starry sky neutral decal skin for Nintendo Switch Console ..
$22.00
Starry sky decal skin for Nintendo Switch Console and Cont..
Starry sky decal skin for Nintendo Switch Console and Cont..
$22.00
Star wars decal skin for Nintendo Switch Console and Contr..
Star wars decal skin for Nintendo Switch Console and Contr..
$22.00
Star wars decal skin for Nintendo Switch Console and Contr..
Star wars decal skin for Nintendo Switch Console and Contr..
$22.00
Star wars decal skin for Nintendo Switch Console and Contr..
Star wars decal skin for Nintendo Switch Console and Contr..
$22.00
Star wars Battlefront decal skin for Nintendo Switch Conso..
Star wars Battlefront decal skin for Nintendo Switch Conso..
$22.00
Splatoon 2 decal skin for Nintendo Switch Console and Cont..
Splatoon 2 decal skin for Nintendo Switch Console and Cont..
$22.00
Splatoon 2 decal skin for Nintendo Switch Console and Cont..
Splatoon 2 decal skin for Nintendo Switch Console and Cont..
$22.00
Splatoon 2 decal skin for Nintendo Switch Console and Cont..
Splatoon 2 decal skin for Nintendo Switch Console and Cont..
$22.00
Splatoon 2 decal skin for Nintendo Switch Console and Cont..
Splatoon 2 decal skin for Nintendo Switch Console and Cont..
$22.00
Spirited Away decal skin for Nintendo Switch Console and C..
Spirited Away decal skin for Nintendo Switch Console and C..
$22.00
Spiderman decal skin for Nintendo Switch Console and Contr..
Spiderman decal skin for Nintendo Switch Console and Contr..
$22.00
Spiderman decal skin for Nintendo Switch Console and Contr..
Spiderman decal skin for Nintendo Switch Console and Contr..
$22.00
South Park decal skin for Nintendo Switch Console and Cont..
South Park decal skin for Nintendo Switch Console and Cont..
$22.00
Sony Classic PS decal skin for Nintendo Switch Console and..
Sony Classic PS decal skin for Nintendo Switch Console and..
$22.00
Sonic the Hedgehog decal skin for Nintendo Switch Console ..
Sonic the Hedgehog decal skin for Nintendo Switch Console ..
$22.00
Sonic the Hedgehog decal skin for Nintendo Switch Console ..
Sonic the Hedgehog decal skin for Nintendo Switch Console ..
$22.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i