Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Pro Skins
PS4 Pro Skin's Store PS4 Pro Skin's Store 2 PS4 Pro Skin's Store 3 PS4 Pro Skin's Store 4 PS4 Pro Skin's Store 5 PS4 Pro Skin's Store 6 PS4 Pro Skin's Store 7 PS4 Pro Skin's Store 8
Kirito decal skin for PS4 Pro Console and 2 Controllers
Kirito decal skin for PS4 Pro Console and 2 Controllers
$24.00
Kobe bryant decal skin for PS4 Pro Console and 2 Controllers
Kobe bryant decal skin for PS4 Pro Console and 2 Controllers
$24.00
Laptop circuit decal skin for PS4 Pro Console and 2 Contro..
Laptop circuit decal skin for PS4 Pro Console and 2 Contro..
$24.00
Lionel Messi decal skin for PS4 Pro Console and 2 Controll..
Lionel Messi decal skin for PS4 Pro Console and 2 Controll..
$24.00
Los Angeles Kings decal skin for PS4 Pro Console and 2 Con..
Los Angeles Kings decal skin for PS4 Pro Console and 2 Con..
$24.00
Los Angeles Lakers decal skin for PS4 Pro Console and 2 Co..
Los Angeles Lakers decal skin for PS4 Pro Console and 2 Co..
$24.00
Machine Interface decal skin for PS4 Pro Console and 2 Con..
Machine Interface decal skin for PS4 Pro Console and 2 Con..
$24.00
Mafia 3 decal skin for PS4 Pro Console and 2 Controllers
Mafia 3 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Mafia 3 decal skin for PS4 Pro Console and 2 Controllers
Mafia 3 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Mafia 3 decal skin for PS4 Pro Console and 2 Controllers
Mafia 3 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Mafia 3 the black mob decal skin for PS4 Pro Console and 2..
Mafia 3 the black mob decal skin for PS4 Pro Console and 2..
$24.00
Manchester City FC decal skin for PS4 Pro Console and 2 Co..
Manchester City FC decal skin for PS4 Pro Console and 2 Co..
$24.00
Manchester United decal skin for PS4 Pro Console and 2 Con..
Manchester United decal skin for PS4 Pro Console and 2 Con..
$24.00
Manchester United decal skin for PS4 Pro Console and 2 Con..
Manchester United decal skin for PS4 Pro Console and 2 Con..
$24.00
Manchester United decal skin for PS4 Pro Console and 2 Con..
Manchester United decal skin for PS4 Pro Console and 2 Con..
$24.00
Manchester United decal skin for PS4 Pro Console and 2 Con..
Manchester United decal skin for PS4 Pro Console and 2 Con..
$24.00
Manchester United decal skin for PS4 Pro Console and 2 Con..
Manchester United decal skin for PS4 Pro Console and 2 Con..
$24.00
Manchester United decal skin for PS4 Pro Console and 2 Con..
Manchester United decal skin for PS4 Pro Console and 2 Con..
$24.00
Mascot for uc davis decal skin for PS4 Pro Console and 2 C..
Mascot for uc davis decal skin for PS4 Pro Console and 2 C..
$24.00
Men Women Symbol decal skin for PS4 Pro Console and 2 Cont..
Men Women Symbol decal skin for PS4 Pro Console and 2 Cont..
$24.00
Metal Floor decal skin for PS4 Pro Console and 2 Controllers
Metal Floor decal skin for PS4 Pro Console and 2 Controllers
$24.00
Metal Gear Solid V decal skin for PS4 Pro Console and 2 Co..
Metal Gear Solid V decal skin for PS4 Pro Console and 2 Co..
$24.00
Metal Skeleton decal skin for PS4 Pro Console and 2 Contro..
Metal Skeleton decal skin for PS4 Pro Console and 2 Contro..
$24.00
Metal Spider decal skin for PS4 Pro Console and 2 Controll..
Metal Spider decal skin for PS4 Pro Console and 2 Controll..
$24.00
Miami Dolphins decal skin for PS4 Pro Console and 2 Contro..
Miami Dolphins decal skin for PS4 Pro Console and 2 Contro..
$24.00
Michael jordan best dunk decal skin for PS4 Pro Console an..
Michael jordan best dunk decal skin for PS4 Pro Console an..
$24.00
Minecraft decal skin for PS4 Pro Console and 2 Controllers
Minecraft decal skin for PS4 Pro Console and 2 Controllers
$24.00
Monster Energy decal skin for PS4 Pro Console and 2 Contro..
Monster Energy decal skin for PS4 Pro Console and 2 Contro..
$24.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i