Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Pro Skins
PS4 Pro Skin's Store PS4 Pro Skin's Store 2 PS4 Pro Skin's Store 3 PS4 Pro Skin's Store 4 PS4 Pro Skin's Store 5 PS4 Pro Skin's Store 6 PS4 Pro Skin's Store 7 PS4 Pro Skin's Store 8
Star wars decal skin for PS4 Pro Console and 2 Controllers
Star wars decal skin for PS4 Pro Console and 2 Controllers
$24.00
Stars of Sky decal skin for PS4 Pro Console and 2 Controll..
Stars of Sky decal skin for PS4 Pro Console and 2 Controll..
$24.00
Star wars decal skin for PS4 Pro Console and 2 Controllers
Star wars decal skin for PS4 Pro Console and 2 Controllers
$24.00
Galaxy New decal skin for PS4 Pro Console and 2 Controllers
Galaxy New decal skin for PS4 Pro Console and 2 Controllers
$24.00
Floor Carpet decal skin for PS4 Pro Console and 2 Controll..
Floor Carpet decal skin for PS4 Pro Console and 2 Controll..
$24.00
White Texture decal skin for PS4 Pro Console and 2 Control..
White Texture decal skin for PS4 Pro Console and 2 Control..
$24.00
Broken Skulls decal skin for PS4 Pro Console and 2 Control..
Broken Skulls decal skin for PS4 Pro Console and 2 Control..
$24.00
Fire Plant decal skin for PS4 Pro Console and 2 Controllers
Fire Plant decal skin for PS4 Pro Console and 2 Controllers
$24.00
Blue Fires decal skin for PS4 Pro Console and 2 Controllers
Blue Fires decal skin for PS4 Pro Console and 2 Controllers
$24.00
Army Dress decal skin for PS4 Pro Console and 2 Controllers
Army Dress decal skin for PS4 Pro Console and 2 Controllers
$24.00
GTA Clipart decal skin for PS4 Pro Console and 2 Controllers
GTA Clipart decal skin for PS4 Pro Console and 2 Controllers
$24.00
PS4 Button decal skin for PS4 Pro Console and 2 Controllers
PS4 Button decal skin for PS4 Pro Console and 2 Controllers
$24.00
Nude Girls decal skin for PS4 Pro Console and 2 Controllers
Nude Girls decal skin for PS4 Pro Console and 2 Controllers
$24.00
Wooden Board decal skin for PS4 Pro Console and 2 Controll..
Wooden Board decal skin for PS4 Pro Console and 2 Controll..
$24.00
Wooden Board decal skin for PS4 Pro Console and 2 Controll..
Wooden Board decal skin for PS4 Pro Console and 2 Controll..
$24.00
Brown Wooden Board decal skin for PS4 Pro Console and 2 Co..
Brown Wooden Board decal skin for PS4 Pro Console and 2 Co..
$24.00
Wooden Board decal skin for PS4 Pro Console and 2 Controll..
Wooden Board decal skin for PS4 Pro Console and 2 Controll..
$24.00
Colorful wooden Board decal skin for PS4 Pro Console and 2..
Colorful wooden Board decal skin for PS4 Pro Console and 2..
$24.00
Wooden Board decal skin for PS4 Pro Console and 2 Controll..
Wooden Board decal skin for PS4 Pro Console and 2 Controll..
$24.00
Glossy Wooden Board decal skin for PS4 Pro Console and 2 C..
Glossy Wooden Board decal skin for PS4 Pro Console and 2 C..
$24.00
Wooden Board decal skin for PS4 Pro Console and 2 Controll..
Wooden Board decal skin for PS4 Pro Console and 2 Controll..
$24.00
Thresh League of Legends champion decal skin for PS4 Pro C..
Thresh League of Legends champion decal skin for PS4 Pro C..
$24.00
Men Women Symbol decal skin for PS4 Pro Console and 2 Cont..
Men Women Symbol decal skin for PS4 Pro Console and 2 Cont..
$24.00
Minecraft decal skin for PS4 Pro Console and 2 Controllers
Minecraft decal skin for PS4 Pro Console and 2 Controllers
$24.00
Weed Flowers decal skin for PS4 Pro Console and 2 Controll..
Weed Flowers decal skin for PS4 Pro Console and 2 Controll..
$24.00
Donald Trump decal skin for PS4 Pro Console and 2 Controll..
Donald Trump decal skin for PS4 Pro Console and 2 Controll..
$24.00
Weed in Waterdrop decal skin for PS4 Pro Console and 2 Con..
Weed in Waterdrop decal skin for PS4 Pro Console and 2 Con..
$24.00
White Texture decal skin for PS4 Pro Console and 2 Control..
White Texture decal skin for PS4 Pro Console and 2 Control..
$24.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i