Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Pro Skins
PS4 Pro Skin's Store PS4 Pro Skin's Store 2 PS4 Pro Skin's Store 3 PS4 Pro Skin's Store 4 PS4 Pro Skin's Store 5 PS4 Pro Skin's Store 6 PS4 Pro Skin's Store 7 PS4 Pro Skin's Store 8
Star wars decal skin for PS4 Pro Console and 2 Controllers
Star wars decal skin for PS4 Pro Console and 2 Controllers
$24.00
Star wars decal skin for PS4 Pro Console and 2 Controllers
Star wars decal skin for PS4 Pro Console and 2 Controllers
$24.00
Star Wars decal skin for PS4 Pro Console and 2 Controllers
Star Wars decal skin for PS4 Pro Console and 2 Controllers
$24.00
Star Wars decal skin for PS4 Pro Console and 2 Controllers
Star Wars decal skin for PS4 Pro Console and 2 Controllers
$24.00
Starry sky decal skin for PS4 Pro Console and 2 Controllers
Starry sky decal skin for PS4 Pro Console and 2 Controllers
$24.00
Starry Sky decal skin for PS4 Pro Console and 2 Controllers
Starry Sky decal skin for PS4 Pro Console and 2 Controllers
$24.00
Stars of Sky decal skin for PS4 Pro Console and 2 Controll..
Stars of Sky decal skin for PS4 Pro Console and 2 Controll..
$24.00
Suicide Squad decal skin for PS4 Pro Console and 2 Control..
Suicide Squad decal skin for PS4 Pro Console and 2 Control..
$24.00
Superman decal skin for PS4 Pro Console and 2 Controllers
Superman decal skin for PS4 Pro Console and 2 Controllers
$24.00
Superman decal skin for PS4 Pro Console and 2 Controllers
Superman decal skin for PS4 Pro Console and 2 Controllers
$24.00
Superman decal skin for PS4 Pro Console and 2 Controllers
Superman decal skin for PS4 Pro Console and 2 Controllers
$24.00
Superman decal skin for PS4 Pro Console and 2 Controllers
Superman decal skin for PS4 Pro Console and 2 Controllers
$24.00
Superman decal skin for PS4 Pro Console and 2 Controllers
Superman decal skin for PS4 Pro Console and 2 Controllers
$24.00
Superman decal skin for PS4 Pro Console and 2 Controllers
Superman decal skin for PS4 Pro Console and 2 Controllers
$24.00
Superman decal skin for PS4 Pro Console and 2 Controllers
Superman decal skin for PS4 Pro Console and 2 Controllers
$24.00
Superman VS Batman decal skin for PS4 Pro Console and 2 Co..
Superman VS Batman decal skin for PS4 Pro Console and 2 Co..
$24.00
Swirl clipart decal skin for PS4 Pro Console and 2 Control..
Swirl clipart decal skin for PS4 Pro Console and 2 Control..
$24.00
Tennessee Titans decal skin for PS4 Pro Console and 2 Cont..
Tennessee Titans decal skin for PS4 Pro Console and 2 Cont..
$24.00
The Celtic football club decal skin for PS4 Pro Console an..
The Celtic football club decal skin for PS4 Pro Console an..
$24.00
The Dark Knight and Joker decal skin for PS4 Pro Console a..
The Dark Knight and Joker decal skin for PS4 Pro Console a..
$24.00
The Elder Scrolls V Skyrim decal skin for PS4 Pro Console ..
The Elder Scrolls V Skyrim decal skin for PS4 Pro Console ..
$24.00
The Elder Scrolls V Skyrim decal skin for PS4 Pro Console ..
The Elder Scrolls V Skyrim decal skin for PS4 Pro Console ..
$24.00
The Force Awakens decal skin for PS4 Pro Console and 2 Con..
The Force Awakens decal skin for PS4 Pro Console and 2 Con..
$24.00
The Incredible Hulk decal skin for PS4 Pro Console and 2 C..
The Incredible Hulk decal skin for PS4 Pro Console and 2 C..
$24.00
The Joker decal skin for PS4 Pro Console and 2 Controllers
The Joker decal skin for PS4 Pro Console and 2 Controllers
$24.00
The Joker decal skin for PS4 Pro Console and 2 Controllers
The Joker decal skin for PS4 Pro Console and 2 Controllers
$24.00
The Joker decal skin for PS4 Pro Console and 2 Controllers
The Joker decal skin for PS4 Pro Console and 2 Controllers
$24.00
The Joker decal skin for PS4 Pro Console and 2 Controllers
The Joker decal skin for PS4 Pro Console and 2 Controllers
$24.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i