Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Pro Skins
PS4 Pro Skin's Store PS4 Pro Skin's Store 2 PS4 Pro Skin's Store 3 PS4 Pro Skin's Store 4 PS4 Pro Skin's Store 5 PS4 Pro Skin's Store 6 PS4 Pro Skin's Store 7 PS4 Pro Skin's Store 8
Call of Duty Black ops 3 decal skin for PS4 Pro Console an..
Call of Duty Black ops 3 decal skin for PS4 Pro Console an..
$24.00
Call of Duty Black ops 3 decal skin for PS4 Pro Console an..
Call of Duty Black ops 3 decal skin for PS4 Pro Console an..
$24.00
Call of Duty Black ops 3 decal skin for PS4 Pro Console an..
Call of Duty Black ops 3 decal skin for PS4 Pro Console an..
$24.00
Call of Duty Black ops 3 decal skin for PS4 Pro Console an..
Call of Duty Black ops 3 decal skin for PS4 Pro Console an..
$24.00
Call of Duty Black ops 3 decal skin for PS4 Pro Console an..
Call of Duty Black ops 3 decal skin for PS4 Pro Console an..
$24.00
Call of Duty Black ops 3 decal skin for PS4 Pro Console an..
Call of Duty Black ops 3 decal skin for PS4 Pro Console an..
$24.00
Call of Duty Black ops 3 decal skin for PS4 Pro Console an..
Call of Duty Black ops 3 decal skin for PS4 Pro Console an..
$24.00
Call of Duty Black ops 2 decal skin for PS4 Pro Console an..
Call of Duty Black ops 2 decal skin for PS4 Pro Console an..
$24.00
Call of Duty Black ops 2 decal skin for PS4 Pro Console an..
Call of Duty Black ops 2 decal skin for PS4 Pro Console an..
$24.00
Call of Duty Black ops 2 decal skin for PS4 Pro Console an..
Call of Duty Black ops 2 decal skin for PS4 Pro Console an..
$24.00
Call of Duty Black ops 2 decal skin for PS4 Pro Console an..
Call of Duty Black ops 2 decal skin for PS4 Pro Console an..
$24.00
Call of Black ops 3 decal skin for PS4 Pro Console and 2 C..
Call of Black ops 3 decal skin for PS4 Pro Console and 2 C..
$24.00
Buffalo Bills decal skin for PS4 Pro Console and 2 Control..
Buffalo Bills decal skin for PS4 Pro Console and 2 Control..
$24.00
Brown Wooden Board decal skin for PS4 Pro Console and 2 Co..
Brown Wooden Board decal skin for PS4 Pro Console and 2 Co..
$24.00
Broken Skulls decal skin for PS4 Pro Console and 2 Control..
Broken Skulls decal skin for PS4 Pro Console and 2 Control..
$24.00
Boston Red sox decal skin for PS4 Pro Console and 2 Contro..
Boston Red sox decal skin for PS4 Pro Console and 2 Contro..
$24.00
Borussia Dortmund decal skin for PS4 Pro Console and 2 Con..
Borussia Dortmund decal skin for PS4 Pro Console and 2 Con..
$24.00
Blue Texture decal skin for PS4 Pro Console and 2 Controll..
Blue Texture decal skin for PS4 Pro Console and 2 Controll..
$24.00
Blue Fires decal skin for PS4 Pro Console and 2 Controllers
Blue Fires decal skin for PS4 Pro Console and 2 Controllers
$24.00
Blue Fires decal skin for PS4 Pro Console and 2 Controllers
Blue Fires decal skin for PS4 Pro Console and 2 Controllers
$24.00
Blue Fire decal skin for PS4 Pro Console and 2 Controllers
Blue Fire decal skin for PS4 Pro Console and 2 Controllers
$24.00
Bloodborne decal skin for PS4 Pro Console and 2 Controllers
Bloodborne decal skin for PS4 Pro Console and 2 Controllers
$24.00
Blood Vein decal skin for PS4 Pro Console and 2 Controllers
Blood Vein decal skin for PS4 Pro Console and 2 Controllers
$24.00
Besiktas JK decal skin for PS4 Pro Console and 2 Controllers
Besiktas JK decal skin for PS4 Pro Console and 2 Controllers
$24.00
Besiktas JK decal skin for PS4 Pro Console and 2 Controllers
Besiktas JK decal skin for PS4 Pro Console and 2 Controllers
$24.00
Besiktas JK decal skin for PS4 Pro Console and 2 Controllers
Besiktas JK decal skin for PS4 Pro Console and 2 Controllers
$24.00
Beautiful Girls decal skin for PS4 Pro Console and 2 Contr..
Beautiful Girls decal skin for PS4 Pro Console and 2 Contr..
$24.00
Battlefield 3 decal skin for PS4 Pro Console and 2 Control..
Battlefield 3 decal skin for PS4 Pro Console and 2 Control..
$24.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i