Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Pro Skins
PS4 Pro Skin's Store PS4 Pro Skin's Store 2 PS4 Pro Skin's Store 3 PS4 Pro Skin's Store 4 PS4 Pro Skin's Store 5 PS4 Pro Skin's Store 6 PS4 Pro Skin's Store 7 PS4 Pro Skin's Store 8
The Joker decal skin for PS4 Pro Console and 2 Controllers
The Joker decal skin for PS4 Pro Console and 2 Controllers
$24.00
The Joker decal skin for PS4 Pro Console and 2 Controllers
The Joker decal skin for PS4 Pro Console and 2 Controllers
$24.00
The Joker decal skin for PS4 Pro Console and 2 Controllers
The Joker decal skin for PS4 Pro Console and 2 Controllers
$24.00
The Joker decal skin for PS4 Pro Console and 2 Controllers
The Joker decal skin for PS4 Pro Console and 2 Controllers
$24.00
The Joker decal skin for PS4 Pro Console and 2 Controllers
The Joker decal skin for PS4 Pro Console and 2 Controllers
$24.00
The Joker decal skin for PS4 Pro Console and 2 Controllers
The Joker decal skin for PS4 Pro Console and 2 Controllers
$24.00
The Joker decal skin for PS4 Pro Console and 2 Controllers
The Joker decal skin for PS4 Pro Console and 2 Controllers
$24.00
The Joker decal skin for PS4 Pro Console and 2 Controllers
The Joker decal skin for PS4 Pro Console and 2 Controllers
$24.00
The Joker decal skin for PS4 Pro Console and 2 Controllers
The Joker decal skin for PS4 Pro Console and 2 Controllers
$24.00
The Joker decal skin for PS4 Pro Console and 2 Controllers
The Joker decal skin for PS4 Pro Console and 2 Controllers
$24.00
The Joker decal skin for PS4 Pro Console and 2 Controllers
The Joker decal skin for PS4 Pro Console and 2 Controllers
$24.00
The Joker decal skin for PS4 Pro Console and 2 Controllers
The Joker decal skin for PS4 Pro Console and 2 Controllers
$24.00
The Joker decal skin for PS4 Pro Console and 2 Controllers
The Joker decal skin for PS4 Pro Console and 2 Controllers
$24.00
The Joker decal skin for PS4 Pro Console and 2 Controllers
The Joker decal skin for PS4 Pro Console and 2 Controllers
$24.00
The Joker vs Harley Quinn decal skin for PS4 Pro Console a..
The Joker vs Harley Quinn decal skin for PS4 Pro Console a..
$24.00
The Last Guardian decal skin for PS4 Pro Console and 2 Con..
The Last Guardian decal skin for PS4 Pro Console and 2 Con..
$24.00
The Last Guardian decal skin for PS4 Pro Console and 2 Con..
The Last Guardian decal skin for PS4 Pro Console and 2 Con..
$24.00
The Last of us decal skin for PS4 Pro Console and 2 Contro..
The Last of us decal skin for PS4 Pro Console and 2 Contro..
$24.00
The Last of us decal skin for PS4 Pro Console and 2 Contro..
The Last of us decal skin for PS4 Pro Console and 2 Contro..
$24.00
The Walking Dead decal skin for PS4 Pro Console and 2 Cont..
The Walking Dead decal skin for PS4 Pro Console and 2 Cont..
$24.00
The Walking Dead decal skin for PS4 Pro Console and 2 Cont..
The Walking Dead decal skin for PS4 Pro Console and 2 Cont..
$24.00
The Walking Dead decal skin for PS4 Pro Console and 2 Cont..
The Walking Dead decal skin for PS4 Pro Console and 2 Cont..
$24.00
The Washington Redskins decal skin for PS4 Pro Console and..
The Washington Redskins decal skin for PS4 Pro Console and..
$24.00
The Witcher 3 wild hunt decal skin for PS4 Pro Console and..
The Witcher 3 wild hunt decal skin for PS4 Pro Console and..
$24.00
Thresh League of Legends champion decal skin for PS4 Pro C..
Thresh League of Legends champion decal skin for PS4 Pro C..
$24.00
Thunder Lighting decal skin for PS4 Pro Console and 2 Cont..
Thunder Lighting decal skin for PS4 Pro Console and 2 Cont..
$24.00
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i