Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Pro Skins
PS4 Pro Skin's Store PS4 Pro Skin's Store 2 PS4 Pro Skin's Store 3 PS4 Pro Skin's Store 4 PS4 Pro Skin's Store 5 PS4 Pro Skin's Store 6 PS4 Pro Skin's Store 7 PS4 Pro Skin's Store 8
Galatasaray SK decal skin for PS4 Pro Console and 2 Contro..
Galatasaray SK decal skin for PS4 Pro Console and 2 Contro..
$24.00
Juventus FC decal skin for PS4 Pro Console and 2 Controllers
Juventus FC decal skin for PS4 Pro Console and 2 Controllers
$24.00
AC Milan decal skin for PS4 Pro Console and 2 Controllers
AC Milan decal skin for PS4 Pro Console and 2 Controllers
$24.00
Italia FGC decal skin for PS4 Pro Console and 2 Controllers
Italia FGC decal skin for PS4 Pro Console and 2 Controllers
$24.00
Real Madrid decal skin for PS4 Pro Console and 2 Controllers
Real Madrid decal skin for PS4 Pro Console and 2 Controllers
$24.00
FC Barcelona decal skin for PS4 Pro Console and 2 Controll..
FC Barcelona decal skin for PS4 Pro Console and 2 Controll..
$24.00
FC Barcelona decal skin for PS4 Pro Console and 2 Controll..
FC Barcelona decal skin for PS4 Pro Console and 2 Controll..
$24.00
Real Madrid decal skin for PS4 Pro Console and 2 Controllers
Real Madrid decal skin for PS4 Pro Console and 2 Controllers
$24.00
Golden Board decal skin for PS4 Pro Console and 2 Controll..
Golden Board decal skin for PS4 Pro Console and 2 Controll..
$24.00
Metal Floor decal skin for PS4 Pro Console and 2 Controllers
Metal Floor decal skin for PS4 Pro Console and 2 Controllers
$24.00
Wooden Board decal skin for PS4 Pro Console and 2 Controll..
Wooden Board decal skin for PS4 Pro Console and 2 Controll..
$24.00
Yellow Board decal skin for PS4 Pro Console and 2 Controll..
Yellow Board decal skin for PS4 Pro Console and 2 Controll..
$24.00
Wooden board decal skin for PS4 Pro Console and 2 Controll..
Wooden board decal skin for PS4 Pro Console and 2 Controll..
$24.00
Golden color decal skin for PS4 Pro Console and 2 Controll..
Golden color decal skin for PS4 Pro Console and 2 Controll..
$24.00
Starry Sky decal skin for PS4 Pro Console and 2 Controllers
Starry Sky decal skin for PS4 Pro Console and 2 Controllers
$24.00
Batman Arkham Knigt decal skin for PS4 Pro Console and 2 C..
Batman Arkham Knigt decal skin for PS4 Pro Console and 2 C..
$24.00
Batman Joker decal skin for PS4 Pro Console and 2 Controll..
Batman Joker decal skin for PS4 Pro Console and 2 Controll..
$24.00
The Joker decal skin for PS4 Pro Console and 2 Controllers
The Joker decal skin for PS4 Pro Console and 2 Controllers
$24.00
Batman Arkham Knigt decal skin for PS4 Pro Console and 2 C..
Batman Arkham Knigt decal skin for PS4 Pro Console and 2 C..
$24.00
The Joker decal skin for PS4 Pro Console and 2 Controllers
The Joker decal skin for PS4 Pro Console and 2 Controllers
$24.00
The Joker decal skin for PS4 Pro Console and 2 Controllers
The Joker decal skin for PS4 Pro Console and 2 Controllers
$24.00
The Joker decal skin for PS4 Pro Console and 2 Controllers
The Joker decal skin for PS4 Pro Console and 2 Controllers
$24.00
The Joker decal skin for PS4 Pro Console and 2 Controllers
The Joker decal skin for PS4 Pro Console and 2 Controllers
$24.00
The Joker decal skin for PS4 Pro Console and 2 Controllers
The Joker decal skin for PS4 Pro Console and 2 Controllers
$24.00
Batman Arkham Knigt decal skin for PS4 Pro Console and 2 C..
Batman Arkham Knigt decal skin for PS4 Pro Console and 2 C..
$24.00
The Joker decal skin for PS4 Pro Console and 2 Controllers
The Joker decal skin for PS4 Pro Console and 2 Controllers
$24.00
The Joker decal skin for PS4 Pro Console and 2 Controllers
The Joker decal skin for PS4 Pro Console and 2 Controllers
$24.00
Call of Duty Modern Warfare 3 decal skin for PS4 Pro Conso..
Call of Duty Modern Warfare 3 decal skin for PS4 Pro Conso..
$24.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i