Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Pro Skins
PS4 Pro Skin's Store PS4 Pro Skin's Store 2 PS4 Pro Skin's Store 3 PS4 Pro Skin's Store 4 PS4 Pro Skin's Store 5 PS4 Pro Skin's Store 6 PS4 Pro Skin's Store 7 PS4 Pro Skin's Store 8
Cristiano Ronaldo 7 decal skin for PS4 Pro Console and 2 C..
Cristiano Ronaldo 7 decal skin for PS4 Pro Console and 2 C..
$24.00
Cristiano Ronaldo decal skin for PS4 Pro Console and 2 Con..
Cristiano Ronaldo decal skin for PS4 Pro Console and 2 Con..
$24.00
Cristiano Ronaldo decal skin for PS4 Pro Console and 2 Con..
Cristiano Ronaldo decal skin for PS4 Pro Console and 2 Con..
$24.00
Croatia Flag decal skin for PS4 Pro Console and 2 Controll..
Croatia Flag decal skin for PS4 Pro Console and 2 Controll..
$24.00
Dallas Cowboys decal skin for PS4 Pro Console and 2 Contro..
Dallas Cowboys decal skin for PS4 Pro Console and 2 Contro..
$24.00
Deadpool decal skin for PS4 Pro Console and 2 Controllers
Deadpool decal skin for PS4 Pro Console and 2 Controllers
$24.00
Deadpool decal skin for PS4 Pro Console and 2 Controllers
Deadpool decal skin for PS4 Pro Console and 2 Controllers
$24.00
Deadpool decal skin for PS4 Pro Console and 2 Controllers
Deadpool decal skin for PS4 Pro Console and 2 Controllers
$24.00
Deadpool decal skin for PS4 Pro Console and 2 Controllers
Deadpool decal skin for PS4 Pro Console and 2 Controllers
$24.00
Deadpool decal skin for PS4 Pro Console and 2 Controllers
Deadpool decal skin for PS4 Pro Console and 2 Controllers
$24.00
Deadpool decal skin for PS4 Pro Console and 2 Controllers
Deadpool decal skin for PS4 Pro Console and 2 Controllers
$24.00
Deadpool decal skin for PS4 Pro Console and 2 Controllers
Deadpool decal skin for PS4 Pro Console and 2 Controllers
$24.00
Deadpool decal skin for PS4 Pro Console and 2 Controllers
Deadpool decal skin for PS4 Pro Console and 2 Controllers
$24.00
Deadpool decal skin for PS4 Pro Console and 2 Controllers
Deadpool decal skin for PS4 Pro Console and 2 Controllers
$24.00
Deadpool decal skin for PS4 Pro Console and 2 Controllers
Deadpool decal skin for PS4 Pro Console and 2 Controllers
$24.00
Deportivo de La Coru�a decal skin for PS4 Pro Console and ..
Deportivo de La Coru�a decal skin for PS4 Pro Console and ..
$24.00
DesTiny Rise of Iron decal skin for PS4 Pro Console and 2 ..
DesTiny Rise of Iron decal skin for PS4 Pro Console and 2 ..
$24.00
DesTiny The Taken King decal skin for PS4 Pro Console and ..
DesTiny The Taken King decal skin for PS4 Pro Console and ..
$24.00
Deus Ex Mankind Divided decal skin for PS4 Pro Console and..
Deus Ex Mankind Divided decal skin for PS4 Pro Console and..
$24.00
Deus Ex Mankind Divided decal skin for PS4 Pro Console and..
Deus Ex Mankind Divided decal skin for PS4 Pro Console and..
$24.00
Deus Ex Mankind Divided decal skin for PS4 Pro Console and..
Deus Ex Mankind Divided decal skin for PS4 Pro Console and..
$24.00
Deus Ex Mankind Divided decal skin for PS4 Pro Console and..
Deus Ex Mankind Divided decal skin for PS4 Pro Console and..
$24.00
Devil Skull decal skin for PS4 Pro Console and 2 Controllers
Devil Skull decal skin for PS4 Pro Console and 2 Controllers
$24.00
Diablo 3 decal skin for PS4 Pro Console and 2 Controllers
Diablo 3 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Dishonored2 decal skin for PS4 Pro Console and 2 Controllers
Dishonored2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Dishonored2 decal skin for PS4 Pro Console and 2 Controllers
Dishonored2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Dishonored2 decal skin for PS4 Pro Console and 2 Controllers
Dishonored2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Doctor Strange decal skin for PS4 Pro Console and 2 Contro..
Doctor Strange decal skin for PS4 Pro Console and 2 Contro..
$24.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i