Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Pro Skins
PS4 Pro Skin's Store PS4 Pro Skin's Store 2 PS4 Pro Skin's Store 3 PS4 Pro Skin's Store 4 PS4 Pro Skin's Store 5 PS4 Pro Skin's Store 6 PS4 Pro Skin's Store 7 PS4 Pro Skin's Store 8
Pok�mon Go Team Instinct decal skin for PS4 Pro Console an..
Pok�mon Go Team Instinct decal skin for PS4 Pro Console an..
$24.00
Pok�mon Go Team Instinct decal skin for PS4 Pro Console an..
Pok�mon Go Team Instinct decal skin for PS4 Pro Console an..
$24.00
Pok�mon Go Team Instinct decal skin for PS4 Pro Console an..
Pok�mon Go Team Instinct decal skin for PS4 Pro Console an..
$24.00
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Watch Dog2 decal skin for PS4 Pro Console and 2 Controllers
Watch Dog2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Watch Dog2 decal skin for PS4 Pro Console and 2 Controllers
Watch Dog2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Watch Dog2 decal skin for PS4 Pro Console and 2 Controllers
Watch Dog2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Watch Dog2 decal skin for PS4 Pro Console and 2 Controllers
Watch Dog2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Mafia 3 decal skin for PS4 Pro Console and 2 Controllers
Mafia 3 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Mafia 3 decal skin for PS4 Pro Console and 2 Controllers
Mafia 3 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Real Madrid decal skin for PS4 Pro Console and 2 Controllers
Real Madrid decal skin for PS4 Pro Console and 2 Controllers
$24.00
Italia FIGC decal skin for PS4 Pro Console and 2 Controllers
Italia FIGC decal skin for PS4 Pro Console and 2 Controllers
$24.00
FC Bayern munchen decal skin for PS4 Pro Console and 2 Con..
FC Bayern munchen decal skin for PS4 Pro Console and 2 Con..
$24.00
Lionel Messi decal skin for PS4 Pro Console and 2 Controll..
Lionel Messi decal skin for PS4 Pro Console and 2 Controll..
$24.00
FC Bayern munchen decal skin for PS4 Pro Console and 2 Con..
FC Bayern munchen decal skin for PS4 Pro Console and 2 Con..
$24.00
Borussia Dortmund decal skin for PS4 Pro Console and 2 Con..
Borussia Dortmund decal skin for PS4 Pro Console and 2 Con..
$24.00
FC Barcelona decal skin for PS4 Pro Console and 2 Controll..
FC Barcelona decal skin for PS4 Pro Console and 2 Controll..
$24.00
Call of Duty MW3 decal skin for PS4 Pro Console and 2 Cont..
Call of Duty MW3 decal skin for PS4 Pro Console and 2 Cont..
$24.00
Anime Girl decal skin for PS4 Pro Console and 2 Controllers
Anime Girl decal skin for PS4 Pro Console and 2 Controllers
$24.00
God of War decal skin for PS4 Pro Console and 2 Controllers
God of War decal skin for PS4 Pro Console and 2 Controllers
$24.00
FC Barca decal skin for PS4 Pro Console and 2 Controllers
FC Barca decal skin for PS4 Pro Console and 2 Controllers
$24.00
Hitman decal skin for PS4 Pro Console and 2 Controllers
Hitman decal skin for PS4 Pro Console and 2 Controllers
$24.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i