Product Added to your Cart
x

-------- OR --------

Default
CroatiaFranceHebrewHungaryVietnameseGreeceCzech RepublicDenmarkRomaniaFinland
USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
PS4 Pro Skin's Store
500 product(s) found for "PS4 Pro Skin's Store"
Borussia Dortmund decal skin..
PS4 Pro Skin's Store
Borussia Dortmund decal skin..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Borussia Dortmund decal skin..
PS4 Pro Skin's Store
Borussia Dortmund decal skin..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Borussia Dortmund decal skin..
PS4 Pro Skin's Store
Borussia Dortmund decal skin..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Borussia Dortmund decal skin..
PS4 Pro Skin's Store
Borussia Dortmund decal skin..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Boston Celtics decal skin fo..
PS4 Pro Skin's Store
Boston Celtics decal skin fo..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Bright stars decal skin for ..
PS4 Pro Skin's Store
Bright stars decal skin for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Brown fiber decal skin for P..
PS4 Pro Skin's Store
Brown fiber decal skin for P..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Buffalo Bills decal skin for..
PS4 Pro Skin's Store
Buffalo Bills decal skin for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Buffalo Bills decal skin for..
PS4 Pro Skin's Store
Buffalo Bills decal skin for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Buffalo Bills decal skin for..
PS4 Pro Skin's Store
Buffalo Bills decal skin for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Buffalo Bills decal skin for..
PS4 Pro Skin's Store
Buffalo Bills decal skin for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Cadiz CF decal skin for PS4 ..
PS4 Pro Skin's Store
Cadiz CF decal skin for PS4 ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Call of Duty 4 Modern Warfar..
PS4 Pro Skin's Store
Call of Duty 4 Modern Warfar..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Call of Duty Black Ops 3 dec..
PS4 Pro Skin's Store
Call of Duty Black Ops 3 dec..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Call of Duty Ghosts decal sk..
PS4 Pro Skin's Store
Call of Duty Ghosts decal sk..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Call of Duty Infinite Warfar..
PS4 Pro Skin's Store
Call of Duty Infinite Warfar..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Call of Duty Infinite Warfar..
PS4 Pro Skin's Store
Call of Duty Infinite Warfar..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Call of Duty Infinite Warfar..
PS4 Pro Skin's Store
Call of Duty Infinite Warfar..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Call of Duty Infinite Warfar..
PS4 Pro Skin's Store
Call of Duty Infinite Warfar..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Call of Duty Infinite Warfar..
PS4 Pro Skin's Store
Call of Duty Infinite Warfar..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Captain America the winter s..
PS4 Pro Skin's Store
Captain America the winter s..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Carbon fiber decal skin for ..
PS4 Pro Skin's Store
Carbon fiber decal skin for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Carolina panthers decal skin..
PS4 Pro Skin's Store
Carolina panthers decal skin..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Chelsea FC decal skin for PS..
PS4 Pro Skin's Store
Chelsea FC decal skin for PS..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Chicago Bears decal skin for..
PS4 Pro Skin's Store
Chicago Bears decal skin for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Chicago Bulls decal skin for..
PS4 Pro Skin's Store
Chicago Bulls decal skin for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Chicago Cubs decal skin for ..
PS4 Pro Skin's Store
Chicago Cubs decal skin for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Cincinnati Bengals decal ski..
PS4 Pro Skin's Store
Cincinnati Bengals decal ski..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i