Product Added to your Cart
x

-------- OR --------

Default
CroatiaFranceHebrewHungaryVietnameseGreeceCzech RepublicDenmarkRomaniaFinland
USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
PS4 Pro Skin's Store 2
500 product(s) found for "PS4 Pro Skin's Store 2"
Cartoon Eye decal skin for P..
PS4 Pro Skin's Store 2
Cartoon Eye decal skin for P..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Bape Wallpaper decal skin fo..
PS4 Pro Skin's Store 2
Bape Wallpaper decal skin fo..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Prismic Pattern decal skin f..
PS4 Pro Skin's Store 2
Prismic Pattern decal skin f..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Wolf decal skin for PS4 Pro ..
PS4 Pro Skin's Store 2
Wolf decal skin for PS4 Pro ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Anime Quote decal skin for P..
PS4 Pro Skin's Store 2
Anime Quote decal skin for P..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Suicide Squad decal skin for..
PS4 Pro Skin's Store 2
Suicide Squad decal skin for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Sticker Bomb decal skin for ..
PS4 Pro Skin's Store 2
Sticker Bomb decal skin for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Sticker Bomb decal skin for ..
PS4 Pro Skin's Store 2
Sticker Bomb decal skin for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Sticker Bomb decal skin for ..
PS4 Pro Skin's Store 2
Sticker Bomb decal skin for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Horizon Zero Dawn decal skin..
PS4 Pro Skin's Store 2
Horizon Zero Dawn decal skin..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Horizon Zero Dawn decal skin..
PS4 Pro Skin's Store 2
Horizon Zero Dawn decal skin..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
White Weed decal skin for PS..
PS4 Pro Skin's Store 2
White Weed decal skin for PS..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Dark Tunnel decal skin for P..
PS4 Pro Skin's Store 2
Dark Tunnel decal skin for P..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Traingle Pattern decal skin ..
PS4 Pro Skin's Store 2
Traingle Pattern decal skin ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Tech Wallpaper decal skin fo..
PS4 Pro Skin's Store 2
Tech Wallpaper decal skin fo..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Destruction City decal skin ..
PS4 Pro Skin's Store 2
Destruction City decal skin ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Tech Wallpaper decal skin fo..
PS4 Pro Skin's Store 2
Tech Wallpaper decal skin fo..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Tech Wallpaper decal skin fo..
PS4 Pro Skin's Store 2
Tech Wallpaper decal skin fo..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Black Cat decal skin for PS4..
PS4 Pro Skin's Store 2
Black Cat decal skin for PS4..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Sky Scene decal skin for PS4..
PS4 Pro Skin's Store 2
Sky Scene decal skin for PS4..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Coloful Diamond decal skin f..
PS4 Pro Skin's Store 2
Coloful Diamond decal skin f..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Tech Wallpaper decal skin fo..
PS4 Pro Skin's Store 2
Tech Wallpaper decal skin fo..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Paris Saint German decal ski..
PS4 Pro Skin's Store 2
Paris Saint German decal ski..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Utrecht FC decal skin for PS..
PS4 Pro Skin's Store 2
Utrecht FC decal skin for PS..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Olympique Lyonnais decal ski..
PS4 Pro Skin's Store 2
Olympique Lyonnais decal ski..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Real Madrid decal skin for P..
PS4 Pro Skin's Store 2
Real Madrid decal skin for P..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Kurumi Tokisaki decal skin f..
PS4 Pro Skin's Store 2
Kurumi Tokisaki decal skin f..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Rainbow six siege decal skin..
PS4 Pro Skin's Store 2
Rainbow six siege decal skin..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i