Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Pro Skin's Store 3
Ferrari decal skin for PS4 Pro Console and 2 Controllers
Ferrari decal skin for PS4 Pro Console and 2 Controllers
$24.00
Fenerbah�e S K decal skin for PS4 Pro Console and 2 Contro..
Fenerbah�e S K decal skin for PS4 Pro Console and 2 Contro..
$24.00
FC Bayern Munich decal skin for PS4 Pro Console and 2 Cont..
FC Bayern Munich decal skin for PS4 Pro Console and 2 Cont..
$24.00
Fast & Furious decal skin for PS4 Pro Console and 2 Contro..
Fast & Furious decal skin for PS4 Pro Console and 2 Contro..
$24.00
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
Far Cry 5 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Fairy Tail decal skin for PS4 Pro Console and 2 Controllers
Fairy Tail decal skin for PS4 Pro Console and 2 Controllers
$24.00
Fairy Tail decal skin for PS4 Pro Console and 2 Controllers
Fairy Tail decal skin for PS4 Pro Console and 2 Controllers
$24.00
Fairy Tail decal skin for PS4 Pro Console and 2 Controllers
Fairy Tail decal skin for PS4 Pro Console and 2 Controllers
$24.00
Fairy Tail decal skin for PS4 Pro Console and 2 Controllers
Fairy Tail decal skin for PS4 Pro Console and 2 Controllers
$24.00
Fairy Tail decal skin for PS4 Pro Console and 2 Controllers
Fairy Tail decal skin for PS4 Pro Console and 2 Controllers
$24.00
Fairy Tail decal skin for PS4 Pro Console and 2 Controllers
Fairy Tail decal skin for PS4 Pro Console and 2 Controllers
$24.00
Dying Light decal skin for PS4 Pro Console and 2 Controllers
Dying Light decal skin for PS4 Pro Console and 2 Controllers
$24.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i