Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Pro Skin's Store 3
Fortnite decal skin for PS4 Pro Console and 2 Controllers
Fortnite decal skin for PS4 Pro Console and 2 Controllers
$24.00
Fortnite decal skin for PS4 Pro Console and 2 Controllers
Fortnite decal skin for PS4 Pro Console and 2 Controllers
$24.00
Fortnite decal skin for PS4 Pro Console and 2 Controllers
Fortnite decal skin for PS4 Pro Console and 2 Controllers
$24.00
Fortnite decal skin for PS4 Pro Console and 2 Controllers
Fortnite decal skin for PS4 Pro Console and 2 Controllers
$24.00
Fortnite decal skin for PS4 Pro Console and 2 Controllers
Fortnite decal skin for PS4 Pro Console and 2 Controllers
$24.00
Galatasaray SK decal skin for PS4 Pro Console and 2 Contro..
Galatasaray SK decal skin for PS4 Pro Console and 2 Contro..
$24.00
Galaxy Scene decal skin for PS4 Pro Console and 2 Controll..
Galaxy Scene decal skin for PS4 Pro Console and 2 Controll..
$24.00
Game of Thrones decal skin for PS4 Pro Console and 2 Contr..
Game of Thrones decal skin for PS4 Pro Console and 2 Contr..
$24.00
Game of Thrones decal skin for PS4 Pro Console and 2 Contr..
Game of Thrones decal skin for PS4 Pro Console and 2 Contr..
$24.00
Girl Smoking Weed decal skin for PS4 Pro Console and 2 Con..
Girl Smoking Weed decal skin for PS4 Pro Console and 2 Con..
$24.00
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
$24.00
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
$24.00
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
$24.00
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
$24.00
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
$24.00
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
$24.00
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
$24.00
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
$24.00
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
$24.00
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
$24.00
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
$24.00
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
$24.00
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
$24.00
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
$24.00
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
$24.00
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
$24.00
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
God of War 4 decal skin for PS4 Pro Console and 2 Controll..
$24.00
God of war decal skin for PS4 Pro Console and 2 Controllers
God of war decal skin for PS4 Pro Console and 2 Controllers
$24.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i