Product Added to your Cart
x

-------- OR --------

Default
CroatiaFranceHebrewHungaryVietnameseGreeceCzech RepublicDenmarkRomaniaFinland
USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
PS4 Pro Skin's Store 5
500 product(s) found for "PS4 Pro Skin's Store 5"
Set Your Goals decal skin fo..
PS4 Pro Skin's Store 5
Set Your Goals decal skin fo..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Camouflage decal skin for PS..
PS4 Pro Skin's Store 5
Camouflage decal skin for PS..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Abstraction decal skin for P..
PS4 Pro Skin's Store 5
Abstraction decal skin for P..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Abstract Retro Burst decal s..
PS4 Pro Skin's Store 5
Abstract Retro Burst decal s..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Snake anime decal skin for P..
PS4 Pro Skin's Store 5
Snake anime decal skin for P..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Emoticon decal skin for PS4 ..
PS4 Pro Skin's Store 5
Emoticon decal skin for PS4 ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Leather cover decal skin for..
PS4 Pro Skin's Store 5
Leather cover decal skin for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Warning decal skin for PS4 P..
PS4 Pro Skin's Store 5
Warning decal skin for PS4 P..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Vintage American girl decal ..
PS4 Pro Skin's Store 5
Vintage American girl decal ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Fortnite decal skin for PS4 ..
PS4 Pro Skin's Store 5
Fortnite decal skin for PS4 ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Fortnite decal skin for PS4 ..
PS4 Pro Skin's Store 5
Fortnite decal skin for PS4 ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Sea of Thieves decal skin fo..
PS4 Pro Skin's Store 5
Sea of Thieves decal skin fo..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Super Smash Bros decal skin ..
PS4 Pro Skin's Store 5
Super Smash Bros decal skin ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Venom decal skin for PS4 Pro..
PS4 Pro Skin's Store 5
Venom decal skin for PS4 Pro..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
The Last of us decal skin fo..
PS4 Pro Skin's Store 5
The Last of us decal skin fo..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Tiger Clipart decal skin for..
PS4 Pro Skin's Store 5
Tiger Clipart decal skin for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Butterflies decal skin for P..
PS4 Pro Skin's Store 5
Butterflies decal skin for P..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Painted Clipart decal skin f..
PS4 Pro Skin's Store 5
Painted Clipart decal skin f..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Tech wallpaper decal skin fo..
PS4 Pro Skin's Store 5
Tech wallpaper decal skin fo..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Galaxy Planet decal skin for..
PS4 Pro Skin's Store 5
Galaxy Planet decal skin for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Galaxy Planet decal skin for..
PS4 Pro Skin's Store 5
Galaxy Planet decal skin for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Sky Scene decal skin for PS4..
PS4 Pro Skin's Store 5
Sky Scene decal skin for PS4..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Space scene decal skin for P..
PS4 Pro Skin's Store 5
Space scene decal skin for P..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Painted Picture decal skin f..
PS4 Pro Skin's Store 5
Painted Picture decal skin f..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Spiral pattern decal skin fo..
PS4 Pro Skin's Store 5
Spiral pattern decal skin fo..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Animated Picture decal skin ..
PS4 Pro Skin's Store 5
Animated Picture decal skin ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Colors flames decal skin for..
PS4 Pro Skin's Store 5
Colors flames decal skin for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Colorful Columns decal skin ..
PS4 Pro Skin's Store 5
Colorful Columns decal skin ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$24.00
Units in Stock: 999
$24.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i