Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skins
PS4 Slim Skins
PS4 Slim Skin's Store PS4 Slim Skin's Store 2 PS4 Slim Skin's Store 3 PS4 Slim Skin's Store 4 PS4 Slim Skin's Store 5 PS4 Slim Skin's Store 6 PS4 Slim Skin's Store 7 PS4 Slim Skin's Store 8 PS4 Slim Skin's Store 9
Cyberpunk 2077 decal skin for PS4 Slim Console & Controllers
Cyberpunk 2077 decal skin for PS4 Slim Console & Controllers
$23.00
Green Glossy decal skin for PS4 Slim Console and two contr..
Green Glossy decal skin for PS4 Slim Console and two contr..
$23.00
Silver Glossy decal skin for PS4 Slim Console and two cont..
Silver Glossy decal skin for PS4 Slim Console and two cont..
$23.00
Red Glossy decal skin for PS4 Slim Console and two control..
Red Glossy decal skin for PS4 Slim Console and two control..
$23.00
Blue Glossy decal skin for PS4 Slim Console and two contro..
Blue Glossy decal skin for PS4 Slim Console and two contro..
$23.00
Radioactive hazards decal skin for PS4 Slim Console and tw..
Radioactive hazards decal skin for PS4 Slim Console and tw..
$23.00
Pink Glossy decal skin for PS4 Slim Console and two contro..
Pink Glossy decal skin for PS4 Slim Console and two contro..
$23.00
PS4 Classic decal skin for PS4 Slim Console and two contro..
PS4 Classic decal skin for PS4 Slim Console and two contro..
$23.00
Laptop circuit decal skin for PS4 Slim Console and two con..
Laptop circuit decal skin for PS4 Slim Console and two con..
$23.00
Machine hardware decal skin for PS4 Slim Console and two c..
Machine hardware decal skin for PS4 Slim Console and two c..
$23.00
Plant cell clipart decal skin for PS4 Slim Console and two..
Plant cell clipart decal skin for PS4 Slim Console and two..
$23.00
Punk Rock decal skin for PS4 Slim Console and two controll..
Punk Rock decal skin for PS4 Slim Console and two controll..
$23.00
Smoky skull decal skin for PS4 Slim Console and two contro..
Smoky skull decal skin for PS4 Slim Console and two contro..
$23.00
Devil skull decal skin for PS4 Slim Console and two contro..
Devil skull decal skin for PS4 Slim Console and two contro..
$23.00
Toxic Wallpapers decal skin for PS4 Slim Console and two c..
Toxic Wallpapers decal skin for PS4 Slim Console and two c..
$23.00
Icy skull decal skin for PS4 Slim Console and two controll..
Icy skull decal skin for PS4 Slim Console and two controll..
$23.00
Floral skull decal skin for PS4 Slim Console and two contr..
Floral skull decal skin for PS4 Slim Console and two contr..
$23.00
Rectangular pattern decal skin for PS4 Slim Console and tw..
Rectangular pattern decal skin for PS4 Slim Console and tw..
$23.00
Morning wood camo decal skin for PS4 Slim Console and two ..
Morning wood camo decal skin for PS4 Slim Console and two ..
$23.00
Jelyfish clipart decal skin for PS4 Slim Console and two c..
Jelyfish clipart decal skin for PS4 Slim Console and two c..
$23.00
Lie rabbits decal skin for PS4 Slim Console and two contro..
Lie rabbits decal skin for PS4 Slim Console and two contro..
$23.00
Cirtcuit diagram clipart decal skin for PS4 Slim Console a..
Cirtcuit diagram clipart decal skin for PS4 Slim Console a..
$23.00
Tree bark decal skin for PS4 Slim Console and two controll..
Tree bark decal skin for PS4 Slim Console and two controll..
$23.00
Red board decal skin for PS4 Slim Console and two controll..
Red board decal skin for PS4 Slim Console and two controll..
$23.00
Blue board decal skin for PS4 Slim Console and two control..
Blue board decal skin for PS4 Slim Console and two control..
$23.00
Love wallpaper decal skin for PS4 Slim Console and two con..
Love wallpaper decal skin for PS4 Slim Console and two con..
$23.00
PS4 white decal skin for PS4 Slim Console and two controll..
PS4 white decal skin for PS4 Slim Console and two controll..
$23.00
Weed water decal skin for PS4 Slim Console and two control..
Weed water decal skin for PS4 Slim Console and two control..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i