Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skins
PS4 Slim Skins
PS4 Slim Skin's Store PS4 Slim Skin's Store 2 PS4 Slim Skin's Store 3 PS4 Slim Skin's Store 4 PS4 Slim Skin's Store 5 PS4 Slim Skin's Store 6 PS4 Slim Skin's Store 7 PS4 Slim Skin's Store 8 PS4 Slim Skin's Store 9
Monster Engergy decal skin for PS4 Slim Console and two co..
Monster Engergy decal skin for PS4 Slim Console and two co..
$23.00
Morning wood camo decal skin for PS4 Slim Console and two ..
Morning wood camo decal skin for PS4 Slim Console and two ..
$23.00
Naruto shippuden decal skin for PS4 Slim Console and two c..
Naruto shippuden decal skin for PS4 Slim Console and two c..
$23.00
New England Patriots decal skin for PS4 Slim Console and t..
New England Patriots decal skin for PS4 Slim Console and t..
$23.00
New England Patriots decal skin for PS4 Slim Console and t..
New England Patriots decal skin for PS4 Slim Console and t..
$23.00
New England Patriots decal skin for PS4 Slim Console and t..
New England Patriots decal skin for PS4 Slim Console and t..
$23.00
New England Patriots decal skin for PS4 Slim Console and t..
New England Patriots decal skin for PS4 Slim Console and t..
$23.00
New Orleans Saints decal skin for PS4 Slim Console and two..
New Orleans Saints decal skin for PS4 Slim Console and two..
$23.00
New York Jets decal skin for PS4 Slim Console and two cont..
New York Jets decal skin for PS4 Slim Console and two cont..
$23.00
New York Jets decal skin for PS4 Slim Console and two cont..
New York Jets decal skin for PS4 Slim Console and two cont..
$23.00
New York Jets decal skin for PS4 Slim Console and two cont..
New York Jets decal skin for PS4 Slim Console and two cont..
$23.00
New York Jets decal skin for PS4 Slim Console and two cont..
New York Jets decal skin for PS4 Slim Console and two cont..
$23.00
New York Knicks decal skin for PS4 Slim Console and two co..
New York Knicks decal skin for PS4 Slim Console and two co..
$23.00
New York Knicks decal skin for PS4 Slim Console and two co..
New York Knicks decal skin for PS4 Slim Console and two co..
$23.00
NFC Champions Logo decal skin for PS4 Slim Console and two..
NFC Champions Logo decal skin for PS4 Slim Console and two..
$23.00
Nice planet decal skin for PS4 Slim Console and two contro..
Nice planet decal skin for PS4 Slim Console and two contro..
$23.00
Night stars decal skin for PS4 Slim Console and two contro..
Night stars decal skin for PS4 Slim Console and two contro..
$23.00
No man's sky decal skin for PS4 Slim Console and two contr..
No man's sky decal skin for PS4 Slim Console and two contr..
$23.00
No man's sky decal skin for PS4 Slim Console and two contr..
No man's sky decal skin for PS4 Slim Console and two contr..
$23.00
No man's sky decal skin for PS4 Slim Console and two contr..
No man's sky decal skin for PS4 Slim Console and two contr..
$23.00
No man's sky decal skin for PS4 Slim Console and two contr..
No man's sky decal skin for PS4 Slim Console and two contr..
$23.00
No man's sky decal skin for PS4 Slim Console and two contr..
No man's sky decal skin for PS4 Slim Console and two contr..
$23.00
No man's sky decal skin for PS4 Slim Console and two contr..
No man's sky decal skin for PS4 Slim Console and two contr..
$23.00
No man's sky decal skin for PS4 Slim Console and two contr..
No man's sky decal skin for PS4 Slim Console and two contr..
$23.00
No man's sky decal skin for PS4 Slim Console and two contr..
No man's sky decal skin for PS4 Slim Console and two contr..
$23.00
Nude girls decal skin for PS4 Slim Console and two control..
Nude girls decal skin for PS4 Slim Console and two control..
$23.00
Nuka Cola Vault boy decal skin for PS4 Slim Console and tw..
Nuka Cola Vault boy decal skin for PS4 Slim Console and tw..
$23.00
NY Super bowl decal skin for PS4 Slim Console and two cont..
NY Super bowl decal skin for PS4 Slim Console and two cont..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i