Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skins
PS4 Slim Skins
PS4 Slim Skin's Store PS4 Slim Skin's Store 2 PS4 Slim Skin's Store 3 PS4 Slim Skin's Store 4 PS4 Slim Skin's Store 5 PS4 Slim Skin's Store 6 PS4 Slim Skin's Store 7 PS4 Slim Skin's Store 8 PS4 Slim Skin's Store 9
Pokemon Go decal skin for PS4 Slim Console and two control..
Pokemon Go decal skin for PS4 Slim Console and two control..
$23.00
Pokemon go team instinct decal skin for PS4 Slim Console a..
Pokemon go team instinct decal skin for PS4 Slim Console a..
$23.00
Pokemon go team mystic decal skin for PS4 Slim Console and..
Pokemon go team mystic decal skin for PS4 Slim Console and..
$23.00
Pokemon go team valor decal skin for PS4 Slim Console and ..
Pokemon go team valor decal skin for PS4 Slim Console and ..
$23.00
Portland Winterhawks decal skin for PS4 Slim Console and t..
Portland Winterhawks decal skin for PS4 Slim Console and t..
$23.00
Poured color decal skin for PS4 Slim Console and two contr..
Poured color decal skin for PS4 Slim Console and two contr..
$23.00
Prismic Reaction decal skin for PS4 Slim Console and two c..
Prismic Reaction decal skin for PS4 Slim Console and two c..
$23.00
PS4 Classic decal skin for PS4 Slim Console and two contro..
PS4 Classic decal skin for PS4 Slim Console and two contro..
$23.00
PS4 white decal skin for PS4 Slim Console and two controll..
PS4 white decal skin for PS4 Slim Console and two controll..
$23.00
Public Call box decal skin for PS4 Slim Console and two co..
Public Call box decal skin for PS4 Slim Console and two co..
$23.00
Punk Rock decal skin for PS4 Slim Console and two controll..
Punk Rock decal skin for PS4 Slim Console and two controll..
$23.00
Radioactive hazards decal skin for PS4 Slim Console and tw..
Radioactive hazards decal skin for PS4 Slim Console and tw..
$23.00
Radioactive hazards decal skin for PS4 Slim Console and tw..
Radioactive hazards decal skin for PS4 Slim Console and tw..
$23.00
Real Betis decal skin for PS4 Slim Console and two control..
Real Betis decal skin for PS4 Slim Console and two control..
$23.00
Real Club Deportivo decal skin for PS4 Slim Console and tw..
Real Club Deportivo decal skin for PS4 Slim Console and tw..
$23.00
Real Madrid CF decal skin for PS4 Slim Console and two con..
Real Madrid CF decal skin for PS4 Slim Console and two con..
$23.00
Real Madrid CF decal skin for PS4 Slim Console and two con..
Real Madrid CF decal skin for PS4 Slim Console and two con..
$23.00
Real Madrid CF decal skin for PS4 Slim Console and two con..
Real Madrid CF decal skin for PS4 Slim Console and two con..
$23.00
Real Madrid CF decal skin for PS4 Slim Console and two con..
Real Madrid CF decal skin for PS4 Slim Console and two con..
$23.00
Real Madrid CF decal skin for PS4 Slim Console and two con..
Real Madrid CF decal skin for PS4 Slim Console and two con..
$23.00
Real Madrid CF decal skin for PS4 Slim Console and two con..
Real Madrid CF decal skin for PS4 Slim Console and two con..
$23.00
Real Madrid CF decal skin for PS4 Slim Console and two con..
Real Madrid CF decal skin for PS4 Slim Console and two con..
$23.00
Real Madrid CF decal skin for PS4 Slim Console and two con..
Real Madrid CF decal skin for PS4 Slim Console and two con..
$23.00
Real Madrid CF decal skin for PS4 Slim Console and two con..
Real Madrid CF decal skin for PS4 Slim Console and two con..
$23.00
Real Madrid CF decal skin for PS4 Slim Console and two con..
Real Madrid CF decal skin for PS4 Slim Console and two con..
$23.00
Real Madrid CF decal skin for PS4 Slim Console and two con..
Real Madrid CF decal skin for PS4 Slim Console and two con..
$23.00
Real Madrid CF decal skin for PS4 Slim Console and two con..
Real Madrid CF decal skin for PS4 Slim Console and two con..
$23.00
Real Madrid CF decal skin for PS4 Slim Console and two con..
Real Madrid CF decal skin for PS4 Slim Console and two con..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i