Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skins
PS4 Slim Skins
PS4 Slim Skin's Store PS4 Slim Skin's Store 2 PS4 Slim Skin's Store 3 PS4 Slim Skin's Store 4 PS4 Slim Skin's Store 5 PS4 Slim Skin's Store 6 PS4 Slim Skin's Store 7 PS4 Slim Skin's Store 8 PS4 Slim Skin's Store 9
Real Madrid CF decal skin for PS4 Slim Console and two con..
Real Madrid CF decal skin for PS4 Slim Console and two con..
$23.00
Real Madrid CF decal skin for PS4 Slim Console and two con..
Real Madrid CF decal skin for PS4 Slim Console and two con..
$23.00
Real Madrid decal skin for PS4 Slim Console and two contro..
Real Madrid decal skin for PS4 Slim Console and two contro..
$23.00
Real Madrid decal skin for PS4 Slim Console and two contro..
Real Madrid decal skin for PS4 Slim Console and two contro..
$23.00
Real Madrid decal skin for PS4 Slim Console and two contro..
Real Madrid decal skin for PS4 Slim Console and two contro..
$23.00
Rectangular pattern decal skin for PS4 Slim Console and tw..
Rectangular pattern decal skin for PS4 Slim Console and tw..
$23.00
Red board decal skin for PS4 Slim Console and two controll..
Red board decal skin for PS4 Slim Console and two controll..
$23.00
Red fiber decal skin for PS4 Slim Console and two controll..
Red fiber decal skin for PS4 Slim Console and two controll..
$23.00
Red fiber decal skin for PS4 Slim Console and two controll..
Red fiber decal skin for PS4 Slim Console and two controll..
$23.00
Red Glossy decal skin for PS4 Slim Console and two control..
Red Glossy decal skin for PS4 Slim Console and two control..
$23.00
Resident evil wallpaper decal skin for PS4 Slim Console an..
Resident evil wallpaper decal skin for PS4 Slim Console an..
$23.00
Rise of the Tomb Raider decal skin for PS4 Slim Console an..
Rise of the Tomb Raider decal skin for PS4 Slim Console an..
$23.00
Rock skulls decal skin for PS4 Slim Console and two contro..
Rock skulls decal skin for PS4 Slim Console and two contro..
$23.00
S S C Napoli decal skin for PS4 Slim Console and two contr..
S S C Napoli decal skin for PS4 Slim Console and two contr..
$23.00
San Diego Chargers decal skin for PS4 Slim Console and two..
San Diego Chargers decal skin for PS4 Slim Console and two..
$23.00
San Francisco 49ers decal skin for PS4 Slim Console and tw..
San Francisco 49ers decal skin for PS4 Slim Console and tw..
$23.00
Seattle Seahawks decal skin for PS4 Slim Console and two c..
Seattle Seahawks decal skin for PS4 Slim Console and two c..
$23.00
Sevilla FC decal skin for PS4 Slim Console and two control..
Sevilla FC decal skin for PS4 Slim Console and two control..
$23.00
Sexy ass decal skin for PS4 Slim Console and two controllers
Sexy ass decal skin for PS4 Slim Console and two controllers
$23.00
Sexy girl decal skin for PS4 Slim Console and two controll..
Sexy girl decal skin for PS4 Slim Console and two controll..
$23.00
Sexy girls decal skin for PS4 Slim Console and two control..
Sexy girls decal skin for PS4 Slim Console and two control..
$23.00
Sexy nice girl decal skin for PS4 Slim Console and two con..
Sexy nice girl decal skin for PS4 Slim Console and two con..
$23.00
Silky weed decal skin for PS4 Slim Console and two control..
Silky weed decal skin for PS4 Slim Console and two control..
$23.00
Silver Glossy decal skin for PS4 Slim Console and two cont..
Silver Glossy decal skin for PS4 Slim Console and two cont..
$23.00
Sky scene decal skin for PS4 Slim Console and two controll..
Sky scene decal skin for PS4 Slim Console and two controll..
$23.00
Sky stars decal skin for PS4 Slim Console and two controll..
Sky stars decal skin for PS4 Slim Console and two controll..
$23.00
SL Benfica decal skin for PS4 Slim Console and two control..
SL Benfica decal skin for PS4 Slim Console and two control..
$23.00
Smoky skull decal skin for PS4 Slim Console and two contro..
Smoky skull decal skin for PS4 Slim Console and two contro..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i