Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skins
PS4 Slim Skins
PS4 Slim Skin's Store PS4 Slim Skin's Store 2 PS4 Slim Skin's Store 3 PS4 Slim Skin's Store 4 PS4 Slim Skin's Store 5 PS4 Slim Skin's Store 6 PS4 Slim Skin's Store 7 PS4 Slim Skin's Store 8 PS4 Slim Skin's Store 9
Buffalo Bills decal skin for PS4 Slim Console and two cont..
Buffalo Bills decal skin for PS4 Slim Console and two cont..
$23.00
Buffalo Bills decal skin for PS4 Slim Console and two cont..
Buffalo Bills decal skin for PS4 Slim Console and two cont..
$23.00
Call of duty black ops 3 decal skin for PS4 Slim Console a..
Call of duty black ops 3 decal skin for PS4 Slim Console a..
$23.00
Call of duty black ops 3 decal skin for PS4 Slim Console a..
Call of duty black ops 3 decal skin for PS4 Slim Console a..
$23.00
Camo Art decal skin for PS4 Slim Console and two controllers
Camo Art decal skin for PS4 Slim Console and two controllers
$23.00
Camouflage art decal skin for PS4 Slim Console and two con..
Camouflage art decal skin for PS4 Slim Console and two con..
$23.00
Captain America decal skin for PS4 Slim Console and two co..
Captain America decal skin for PS4 Slim Console and two co..
$23.00
Captain America decal skin for PS4 Slim Console and two co..
Captain America decal skin for PS4 Slim Console and two co..
$23.00
Captain America decal skin for PS4 Slim Console and two co..
Captain America decal skin for PS4 Slim Console and two co..
$23.00
Captain America decal skin for PS4 Slim Console and two co..
Captain America decal skin for PS4 Slim Console and two co..
$23.00
Captain America the winter soldier decal skin for PS4 Slim..
Captain America the winter soldier decal skin for PS4 Slim..
$23.00
Carbon fiber decal skin for PS4 Slim Console and two contr..
Carbon fiber decal skin for PS4 Slim Console and two contr..
$23.00
Carolina Panthers decal skin for PS4 Slim Console and two ..
Carolina Panthers decal skin for PS4 Slim Console and two ..
$23.00
Chelsea FC decal skin for PS4 Slim Console and two control..
Chelsea FC decal skin for PS4 Slim Console and two control..
$23.00
Chelsea FC decal skin for PS4 Slim Console and two control..
Chelsea FC decal skin for PS4 Slim Console and two control..
$23.00
Chicago Bears decal skin for PS4 Slim Console and two cont..
Chicago Bears decal skin for PS4 Slim Console and two cont..
$23.00
Chicago Blackhawks decal skin for PS4 Slim Console and two..
Chicago Blackhawks decal skin for PS4 Slim Console and two..
$23.00
Cincinnati Bengals decal skin for PS4 Slim Console and two..
Cincinnati Bengals decal skin for PS4 Slim Console and two..
$23.00
Cincinnati Bengals decal skin for PS4 Slim Console and two..
Cincinnati Bengals decal skin for PS4 Slim Console and two..
$23.00
Cirtcuit diagram clipart decal skin for PS4 Slim Console a..
Cirtcuit diagram clipart decal skin for PS4 Slim Console a..
$23.00
Classic design decal skin for PS4 Slim Console and two con..
Classic design decal skin for PS4 Slim Console and two con..
$23.00
Cleveland Browns decal skin for PS4 Slim Console and two c..
Cleveland Browns decal skin for PS4 Slim Console and two c..
$23.00
Cleveland Browns decal skin for PS4 Slim Console and two c..
Cleveland Browns decal skin for PS4 Slim Console and two c..
$23.00
Cleveland Cavaliers decal skin for PS4 Slim Console and tw..
Cleveland Cavaliers decal skin for PS4 Slim Console and tw..
$23.00
Cleveland Cavaliers decal skin for PS4 Slim Console and tw..
Cleveland Cavaliers decal skin for PS4 Slim Console and tw..
$23.00
Cleveland Cavaliers decal skin for PS4 Slim Console and tw..
Cleveland Cavaliers decal skin for PS4 Slim Console and tw..
$23.00
Colo Colo Soccer Club decal skin for PS4 Slim Console and ..
Colo Colo Soccer Club decal skin for PS4 Slim Console and ..
$23.00
Colored wooden board decal skin for PS4 Slim Console and t..
Colored wooden board decal skin for PS4 Slim Console and t..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i