Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skins
PS4 Slim Skins
PS4 Slim Skin's Store PS4 Slim Skin's Store 2 PS4 Slim Skin's Store 3 PS4 Slim Skin's Store 4 PS4 Slim Skin's Store 5 PS4 Slim Skin's Store 6 PS4 Slim Skin's Store 7 PS4 Slim Skin's Store 8 PS4 Slim Skin's Store 9
Army camouflage decal skin for PS4 Slim Console and two co..
Army camouflage decal skin for PS4 Slim Console and two co..
$23.00
Silky weed decal skin for PS4 Slim Console and two control..
Silky weed decal skin for PS4 Slim Console and two control..
$23.00
Weed brance decal skin for PS4 Slim Console and two contro..
Weed brance decal skin for PS4 Slim Console and two contro..
$23.00
Starry sky decal skin for PS4 Slim Console and two control..
Starry sky decal skin for PS4 Slim Console and two control..
$23.00
Metal skeleton decal skin for PS4 Slim Console and two con..
Metal skeleton decal skin for PS4 Slim Console and two con..
$23.00
Sticker bomb decal skin for PS4 Slim Console and two contr..
Sticker bomb decal skin for PS4 Slim Console and two contr..
$23.00
Weed 420 decal skin for PS4 Slim Console and two controllers
Weed 420 decal skin for PS4 Slim Console and two controllers
$23.00
Fie weeds decal skin for PS4 Slim Console and two controll..
Fie weeds decal skin for PS4 Slim Console and two controll..
$23.00
Devil atttack decal skin for PS4 Slim Console and two cont..
Devil atttack decal skin for PS4 Slim Console and two cont..
$23.00
Sexy girls decal skin for PS4 Slim Console and two control..
Sexy girls decal skin for PS4 Slim Console and two control..
$23.00
Radioactive hazards decal skin for PS4 Slim Console and tw..
Radioactive hazards decal skin for PS4 Slim Console and tw..
$23.00
White fiber decal skin for PS4 Slim Console and two contro..
White fiber decal skin for PS4 Slim Console and two contro..
$23.00
Carbon fiber decal skin for PS4 Slim Console and two contr..
Carbon fiber decal skin for PS4 Slim Console and two contr..
$23.00
Grey fiber decal skin for PS4 Slim Console and two control..
Grey fiber decal skin for PS4 Slim Console and two control..
$23.00
Green fiber decal skin for PS4 Slim Console and two contro..
Green fiber decal skin for PS4 Slim Console and two contro..
$23.00
Red fiber decal skin for PS4 Slim Console and two controll..
Red fiber decal skin for PS4 Slim Console and two controll..
$23.00
Indigo fiber decal skin for PS4 Slim Console and two contr..
Indigo fiber decal skin for PS4 Slim Console and two contr..
$23.00
Red fiber decal skin for PS4 Slim Console and two controll..
Red fiber decal skin for PS4 Slim Console and two controll..
$23.00
Brown fiber decal skin for PS4 Slim Console and two contro..
Brown fiber decal skin for PS4 Slim Console and two contro..
$23.00
Hatsune miku decal skin for PS4 Slim Console and two contr..
Hatsune miku decal skin for PS4 Slim Console and two contr..
$23.00
Pokemon Go decal skin for PS4 Slim Console and two control..
Pokemon Go decal skin for PS4 Slim Console and two control..
$23.00
Black weed decal skin for PS4 Slim Console and two control..
Black weed decal skin for PS4 Slim Console and two control..
$23.00
Crime Scene Restiction decal skin for PS4 Slim Console and..
Crime Scene Restiction decal skin for PS4 Slim Console and..
$23.00
Blue fires decal skin for PS4 Slim Console and two control..
Blue fires decal skin for PS4 Slim Console and two control..
$23.00
Poured color decal skin for PS4 Slim Console and two contr..
Poured color decal skin for PS4 Slim Console and two contr..
$23.00
Night stars decal skin for PS4 Slim Console and two contro..
Night stars decal skin for PS4 Slim Console and two contro..
$23.00
Stars fair decal skin for PS4 Slim Console and two control..
Stars fair decal skin for PS4 Slim Console and two control..
$23.00
Stars fair decal skin for PS4 Slim Console and two control..
Stars fair decal skin for PS4 Slim Console and two control..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i