Product Added to your Cart
x

-------- OR --------

Default
CroatiaFranceHebrewHungaryVietnameseGreeceCzech RepublicDenmarkRomaniaFinland
USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
PS4 Slim Skins
Sub-Categories
PS4 Slim Skin's StorePS4 Slim Skin's Store 2PS4 Slim Skin's Store 3PS4 Slim Skin's Store 4PS4 Slim Skin's Store 5PS4 Slim Skin's Store 6PS4 Slim Skin's Store 7PS4 Slim Skin's Store 8PS4 Slim Skin's Store 9
501 product(s) found for "PS4 Slim Skins"
Silver Glossy decal skin for..
PS4 Slim Skins
Silver Glossy decal skin for..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Silky weed decal skin for PS..
PS4 Slim Skins
Silky weed decal skin for PS..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Sexy nice girl decal skin fo..
PS4 Slim Skins
Sexy nice girl decal skin fo..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Sexy girls decal skin for PS..
PS4 Slim Skins
Sexy girls decal skin for PS..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Sexy girl decal skin for PS4..
PS4 Slim Skins
Sexy girl decal skin for PS4..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Sexy ass decal skin for PS4 ..
PS4 Slim Skins
Sexy ass decal skin for PS4 ..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Sevilla FC decal skin for PS..
PS4 Slim Skins
Sevilla FC decal skin for PS..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Seattle Seahawks decal skin ..
PS4 Slim Skins
Seattle Seahawks decal skin ..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
San Francisco 49ers decal sk..
PS4 Slim Skins
San Francisco 49ers decal sk..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
San Diego Chargers decal ski..
PS4 Slim Skins
San Diego Chargers decal ski..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
S S C Napoli decal skin for ..
PS4 Slim Skins
S S C Napoli decal skin for ..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Rock skulls decal skin for P..
PS4 Slim Skins
Rock skulls decal skin for P..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Rise of the Tomb Raider deca..
PS4 Slim Skins
Rise of the Tomb Raider deca..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Resident evil wallpaper deca..
PS4 Slim Skins
Resident evil wallpaper deca..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Red Glossy decal skin for PS..
PS4 Slim Skins
Red Glossy decal skin for PS..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Red fiber decal skin for PS4..
PS4 Slim Skins
Red fiber decal skin for PS4..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Red fiber decal skin for PS4..
PS4 Slim Skins
Red fiber decal skin for PS4..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Red board decal skin for PS4..
PS4 Slim Skins
Red board decal skin for PS4..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Rectangular pattern decal sk..
PS4 Slim Skins
Rectangular pattern decal sk..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Real Madrid decal skin for P..
PS4 Slim Skins
Real Madrid decal skin for P..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Real Madrid decal skin for P..
PS4 Slim Skins
Real Madrid decal skin for P..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Real Madrid decal skin for P..
PS4 Slim Skins
Real Madrid decal skin for P..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Real Madrid CF decal skin fo..
PS4 Slim Skins
Real Madrid CF decal skin fo..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Real Madrid CF decal skin fo..
PS4 Slim Skins
Real Madrid CF decal skin fo..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Real Madrid CF decal skin fo..
PS4 Slim Skins
Real Madrid CF decal skin fo..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Real Madrid CF decal skin fo..
PS4 Slim Skins
Real Madrid CF decal skin fo..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Real Madrid CF decal skin fo..
PS4 Slim Skins
Real Madrid CF decal skin fo..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Real Madrid CF decal skin fo..
PS4 Slim Skins
Real Madrid CF decal skin fo..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i