Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skins
PS4 Slim Skins
PS4 Slim Skin's Store PS4 Slim Skin's Store 2 PS4 Slim Skin's Store 3 PS4 Slim Skin's Store 4 PS4 Slim Skin's Store 5 PS4 Slim Skin's Store 6 PS4 Slim Skin's Store 7 PS4 Slim Skin's Store 8 PS4 Slim Skin's Store 9
The Last of us decal skin for PS4 Slim Console and two con..
The Last of us decal skin for PS4 Slim Console and two con..
$23.00
Suicide Squad decal skin for PS4 Slim Console and two cont..
Suicide Squad decal skin for PS4 Slim Console and two cont..
$23.00
Cute Anime decal skin for PS4 Slim Console and two control..
Cute Anime decal skin for PS4 Slim Console and two control..
$23.00
Suicide Squad decal skin for PS4 Slim Console and two cont..
Suicide Squad decal skin for PS4 Slim Console and two cont..
$23.00
Prismic Reaction decal skin for PS4 Slim Console and two c..
Prismic Reaction decal skin for PS4 Slim Console and two c..
$23.00
Floralart decal skin for PS4 Slim Console and two controll..
Floralart decal skin for PS4 Slim Console and two controll..
$23.00
Real Club Deportivo decal skin for PS4 Slim Console and tw..
Real Club Deportivo decal skin for PS4 Slim Console and tw..
$23.00
Dragon Ball decal skin for PS4 Slim Console and two contro..
Dragon Ball decal skin for PS4 Slim Console and two contro..
$23.00
Buffalo Bills decal skin for PS4 Slim Console and two cont..
Buffalo Bills decal skin for PS4 Slim Console and two cont..
$23.00
Harley Quin decal skin for PS4 Slim Console and two contro..
Harley Quin decal skin for PS4 Slim Console and two contro..
$23.00
The Celtic Football Club decal skin for PS4 Slim Console a..
The Celtic Football Club decal skin for PS4 Slim Console a..
$23.00
The Joker decal skin for PS4 Slim Console and two controll..
The Joker decal skin for PS4 Slim Console and two controll..
$23.00
Galaxy scene decal skin for PS4 Slim Console and two contr..
Galaxy scene decal skin for PS4 Slim Console and two contr..
$23.00
New York Knicks decal skin for PS4 Slim Console and two co..
New York Knicks decal skin for PS4 Slim Console and two co..
$23.00
Camo Art decal skin for PS4 Slim Console and two controllers
Camo Art decal skin for PS4 Slim Console and two controllers
$23.00
Sword Art Online decal skin for PS4 Slim Console and two c..
Sword Art Online decal skin for PS4 Slim Console and two c..
$23.00
Sword Art Online decal skin for PS4 Slim Console and two c..
Sword Art Online decal skin for PS4 Slim Console and two c..
$23.00
Dragon ball decal skin for PS4 Slim Console and two contro..
Dragon ball decal skin for PS4 Slim Console and two contro..
$23.00
FC Barcelona decal skin for PS4 Slim Console and two contr..
FC Barcelona decal skin for PS4 Slim Console and two contr..
$23.00
Real Madrid CF decal skin for PS4 Slim Console and two con..
Real Madrid CF decal skin for PS4 Slim Console and two con..
$23.00
Destiny Rise of Iron decal skin for PS4 Slim Console and t..
Destiny Rise of Iron decal skin for PS4 Slim Console and t..
$23.00
New York Knicks decal skin for PS4 Slim Console and two co..
New York Knicks decal skin for PS4 Slim Console and two co..
$23.00
Grand thef auto v decal skin for PS4 Slim Console and two ..
Grand thef auto v decal skin for PS4 Slim Console and two ..
$23.00
Star wars decal skin for PS4 Slim Console and two controll..
Star wars decal skin for PS4 Slim Console and two controll..
$23.00
Public Call box decal skin for PS4 Slim Console and two co..
Public Call box decal skin for PS4 Slim Console and two co..
$23.00
Gin Tama decal skin for PS4 Slim Console and two controllers
Gin Tama decal skin for PS4 Slim Console and two controllers
$23.00
God of War decal skin for PS4 Slim Console and two control..
God of War decal skin for PS4 Slim Console and two control..
$23.00
The Witcher 3 Wild Hunt decal skin for PS4 Slim Console an..
The Witcher 3 Wild Hunt decal skin for PS4 Slim Console an..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i