Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skins
PS4 Slim Skins
PS4 Slim Skin's Store PS4 Slim Skin's Store 2 PS4 Slim Skin's Store 3 PS4 Slim Skin's Store 4 PS4 Slim Skin's Store 5 PS4 Slim Skin's Store 6 PS4 Slim Skin's Store 7 PS4 Slim Skin's Store 8 PS4 Slim Skin's Store 9
Last of us decal skin for PS4 Slim Console and two control..
Last of us decal skin for PS4 Slim Console and two control..
$23.00
Anime Girl decal skin for PS4 Slim Console and two control..
Anime Girl decal skin for PS4 Slim Console and two control..
$23.00
Rise of the Tomb Raider decal skin for PS4 Slim Console an..
Rise of the Tomb Raider decal skin for PS4 Slim Console an..
$23.00
Captain America the winter soldier decal skin for PS4 Slim..
Captain America the winter soldier decal skin for PS4 Slim..
$23.00
Godwar Remastered decal skin for PS4 Slim Console and two ..
Godwar Remastered decal skin for PS4 Slim Console and two ..
$23.00
UK Flag decal skin for PS4 Slim Console and two controllers
UK Flag decal skin for PS4 Slim Console and two controllers
$23.00
Battlefield 1 decal skin for PS4 Slim Console and two cont..
Battlefield 1 decal skin for PS4 Slim Console and two cont..
$23.00
Street Fighter V decal skin for PS4 Slim Console and two c..
Street Fighter V decal skin for PS4 Slim Console and two c..
$23.00
No man's sky decal skin for PS4 Slim Console and two contr..
No man's sky decal skin for PS4 Slim Console and two contr..
$23.00
No man's sky decal skin for PS4 Slim Console and two contr..
No man's sky decal skin for PS4 Slim Console and two contr..
$23.00
No man's sky decal skin for PS4 Slim Console and two contr..
No man's sky decal skin for PS4 Slim Console and two contr..
$23.00
No man's sky decal skin for PS4 Slim Console and two contr..
No man's sky decal skin for PS4 Slim Console and two contr..
$23.00
No man's sky decal skin for PS4 Slim Console and two contr..
No man's sky decal skin for PS4 Slim Console and two contr..
$23.00
No man's sky decal skin for PS4 Slim Console and two contr..
No man's sky decal skin for PS4 Slim Console and two contr..
$23.00
No man's sky decal skin for PS4 Slim Console and two contr..
No man's sky decal skin for PS4 Slim Console and two contr..
$23.00
No man's sky decal skin for PS4 Slim Console and two contr..
No man's sky decal skin for PS4 Slim Console and two contr..
$23.00
Mob Psycho 100 decal skin for PS4 Slim Console and two con..
Mob Psycho 100 decal skin for PS4 Slim Console and two con..
$23.00
Overwatch decal skin for PS4 Slim Console and two controll..
Overwatch decal skin for PS4 Slim Console and two controll..
$23.00
Buffalo Bills decal skin for PS4 Slim Console and two cont..
Buffalo Bills decal skin for PS4 Slim Console and two cont..
$23.00
Buffalo Bills decal skin for PS4 Slim Console and two cont..
Buffalo Bills decal skin for PS4 Slim Console and two cont..
$23.00
Jacksonville Jaguars decal skin for PS4 Slim Console and t..
Jacksonville Jaguars decal skin for PS4 Slim Console and t..
$23.00
Miami Dolphins decal skin for PS4 Slim Console and two con..
Miami Dolphins decal skin for PS4 Slim Console and two con..
$23.00
New York Jets decal skin for PS4 Slim Console and two cont..
New York Jets decal skin for PS4 Slim Console and two cont..
$23.00
New York Jets decal skin for PS4 Slim Console and two cont..
New York Jets decal skin for PS4 Slim Console and two cont..
$23.00
New England Patriots decal skin for PS4 Slim Console and t..
New England Patriots decal skin for PS4 Slim Console and t..
$23.00
New England Patriots decal skin for PS4 Slim Console and t..
New England Patriots decal skin for PS4 Slim Console and t..
$23.00
Houston Texans decal skin for PS4 Slim Console and two con..
Houston Texans decal skin for PS4 Slim Console and two con..
$23.00
Houston Texans decal skin for PS4 Slim Console and two con..
Houston Texans decal skin for PS4 Slim Console and two con..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i