Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skin's Store
Star wars decal skin for PS4 Slim Console and two controll..
Star wars decal skin for PS4 Slim Console and two controll..
$23.00
Star wars decal skin for PS4 Slim Console and two controll..
Star wars decal skin for PS4 Slim Console and two controll..
$23.00
Star wars decal skin for PS4 Slim Console and two controll..
Star wars decal skin for PS4 Slim Console and two controll..
$23.00
Star wars decal skin for PS4 Slim Console and two controll..
Star wars decal skin for PS4 Slim Console and two controll..
$23.00
Star Wars decal skin for PS4 Slim Console and two controll..
Star Wars decal skin for PS4 Slim Console and two controll..
$23.00
Star Wars decal skin for PS4 Slim Console and two controll..
Star Wars decal skin for PS4 Slim Console and two controll..
$23.00
Star wars stormtrooper decal skin for PS4 Slim Console and..
Star wars stormtrooper decal skin for PS4 Slim Console and..
$23.00
Star wars stormtrooper decal skin for PS4 Slim Console and..
Star wars stormtrooper decal skin for PS4 Slim Console and..
$23.00
Star wars stormtrooper decal skin for PS4 Slim Console and..
Star wars stormtrooper decal skin for PS4 Slim Console and..
$23.00
Star wars stormtrooper decal skin for PS4 Slim Console and..
Star wars stormtrooper decal skin for PS4 Slim Console and..
$23.00
Star wars stormtrooper decal skin for PS4 Slim Console and..
Star wars stormtrooper decal skin for PS4 Slim Console and..
$23.00
Star wars stormtrooper decal skin for PS4 Slim Console and..
Star wars stormtrooper decal skin for PS4 Slim Console and..
$23.00
Star wars stormtrooper decal skin for PS4 Slim Console and..
Star wars stormtrooper decal skin for PS4 Slim Console and..
$23.00
Street fighter 4 decal skin for PS4 Slim Console and two c..
Street fighter 4 decal skin for PS4 Slim Console and two c..
$23.00
Street fighter IV decal skin for PS4 Slim Console and two ..
Street fighter IV decal skin for PS4 Slim Console and two ..
$23.00
Suarez decal skin for PS4 Slim Console and two controllers
Suarez decal skin for PS4 Slim Console and two controllers
$23.00
Super Heroes decal skin for PS4 Slim Console and two contr..
Super Heroes decal skin for PS4 Slim Console and two contr..
$23.00
Super Heroes decal skin for PS4 Slim Console and two contr..
Super Heroes decal skin for PS4 Slim Console and two contr..
$23.00
Super Mario decal skin for PS4 Slim Console and two contro..
Super Mario decal skin for PS4 Slim Console and two contro..
$23.00
Superman decal skin for PS4 Slim Console and two controllers
Superman decal skin for PS4 Slim Console and two controllers
$23.00
Superman decal skin for PS4 Slim Console and two controllers
Superman decal skin for PS4 Slim Console and two controllers
$23.00
Superman decal skin for PS4 Slim Console and two controllers
Superman decal skin for PS4 Slim Console and two controllers
$23.00
Superman decal skin for PS4 Slim Console and two controllers
Superman decal skin for PS4 Slim Console and two controllers
$23.00
Superman decal skin for PS4 Slim Console and two controllers
Superman decal skin for PS4 Slim Console and two controllers
$23.00
Superman decal skin for PS4 Slim Console and two controllers
Superman decal skin for PS4 Slim Console and two controllers
$23.00
Superman decal skin for PS4 Slim Console and two controllers
Superman decal skin for PS4 Slim Console and two controllers
$23.00
Superman decal skin for PS4 Slim Console and two controllers
Superman decal skin for PS4 Slim Console and two controllers
$23.00
Superman VS Batman decal skin for PS4 Slim Console and two..
Superman VS Batman decal skin for PS4 Slim Console and two..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i