Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skin's Store
Batman Arkham Origins decal skin for PS4 Slim Console and ..
Batman Arkham Origins decal skin for PS4 Slim Console and ..
$23.00
Batman decal skin for PS4 Slim Console and two controllers
Batman decal skin for PS4 Slim Console and two controllers
$23.00
Batman decal skin for PS4 Slim Console and two controllers
Batman decal skin for PS4 Slim Console and two controllers
$23.00
Batman decal skin for PS4 Slim Console and two controllers
Batman decal skin for PS4 Slim Console and two controllers
$23.00
Batman decal skin for PS4 Slim Console and two controllers
Batman decal skin for PS4 Slim Console and two controllers
$23.00
Batman decal skin for PS4 Slim Console and two controllers
Batman decal skin for PS4 Slim Console and two controllers
$23.00
Batman decal skin for PS4 Slim Console and two controllers
Batman decal skin for PS4 Slim Console and two controllers
$23.00
Batman decal skin for PS4 Slim Console and two controllers
Batman decal skin for PS4 Slim Console and two controllers
$23.00
Batman decal skin for PS4 Slim Console and two controllers
Batman decal skin for PS4 Slim Console and two controllers
$23.00
Batman decal skin for PS4 Slim Console and two controllers
Batman decal skin for PS4 Slim Console and two controllers
$23.00
Batman V Superman decal skin for PS4 Slim Console and two ..
Batman V Superman decal skin for PS4 Slim Console and two ..
$23.00
Batman VS Joker decal skin for PS4 Slim Console and two co..
Batman VS Joker decal skin for PS4 Slim Console and two co..
$23.00
Batman VS Joker decal skin for PS4 Slim Console and two co..
Batman VS Joker decal skin for PS4 Slim Console and two co..
$23.00
Battlefield 1 decal skin for PS4 Slim Console and two cont..
Battlefield 1 decal skin for PS4 Slim Console and two cont..
$23.00
Battlefield 1 decal skin for PS4 Slim Console and two cont..
Battlefield 1 decal skin for PS4 Slim Console and two cont..
$23.00
Battlefield 1 decal skin for PS4 Slim Console and two cont..
Battlefield 1 decal skin for PS4 Slim Console and two cont..
$23.00
Battlefield 1 decal skin for PS4 Slim Console and two cont..
Battlefield 1 decal skin for PS4 Slim Console and two cont..
$23.00
Battlefield 1 decal skin for PS4 Slim Console and two cont..
Battlefield 1 decal skin for PS4 Slim Console and two cont..
$23.00
Battlefield 1 decal skin for PS4 Slim Console and two cont..
Battlefield 1 decal skin for PS4 Slim Console and two cont..
$23.00
Battlefield 1 decal skin for PS4 Slim Console and two cont..
Battlefield 1 decal skin for PS4 Slim Console and two cont..
$23.00
Battlefield 1 decal skin for PS4 Slim Console and two cont..
Battlefield 1 decal skin for PS4 Slim Console and two cont..
$23.00
Battlefield 1 decal skin for PS4 Slim Console and two cont..
Battlefield 1 decal skin for PS4 Slim Console and two cont..
$23.00
Battlefield 1 decal skin for PS4 Slim Console and two cont..
Battlefield 1 decal skin for PS4 Slim Console and two cont..
$23.00
Battlefield 1 decal skin for PS4 Slim Console and two cont..
Battlefield 1 decal skin for PS4 Slim Console and two cont..
$23.00
Battlefield 3 decal skin for PS4 Slim Console and two cont..
Battlefield 3 decal skin for PS4 Slim Console and two cont..
$23.00
Big Hero 6 decal skin for PS4 Slim Console and two control..
Big Hero 6 decal skin for PS4 Slim Console and two control..
$23.00
BJK 1903 decal skin for PS4 Slim Console and two controllers
BJK 1903 decal skin for PS4 Slim Console and two controllers
$23.00
Black hole decal skin for PS4 Slim Console and two control..
Black hole decal skin for PS4 Slim Console and two control..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i