Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skin's Store
Black rock shooter decal skin for PS4 Slim Console and two..
Black rock shooter decal skin for PS4 Slim Console and two..
$23.00
Black Row Style decal skin for PS4 Slim Console and two co..
Black Row Style decal skin for PS4 Slim Console and two co..
$23.00
Bleed blue duke decal skin for PS4 Slim Console and two co..
Bleed blue duke decal skin for PS4 Slim Console and two co..
$23.00
Bloodborne decal skin for PS4 Slim Console and two control..
Bloodborne decal skin for PS4 Slim Console and two control..
$23.00
Bloodborne decal skin for PS4 Slim Console and two control..
Bloodborne decal skin for PS4 Slim Console and two control..
$23.00
Borussia Dortmund decal skin for PS4 Slim Console and two ..
Borussia Dortmund decal skin for PS4 Slim Console and two ..
$23.00
Borussia Dortmund decal skin for PS4 Slim Console and two ..
Borussia Dortmund decal skin for PS4 Slim Console and two ..
$23.00
Borussia Dortmund decal skin for PS4 Slim Console and two ..
Borussia Dortmund decal skin for PS4 Slim Console and two ..
$23.00
Borussia Dortmund decal skin for PS4 Slim Console and two ..
Borussia Dortmund decal skin for PS4 Slim Console and two ..
$23.00
Borussia Dortmund decal skin for PS4 Slim Console and two ..
Borussia Dortmund decal skin for PS4 Slim Console and two ..
$23.00
Borussia Dortmund decal skin for PS4 Slim Console and two ..
Borussia Dortmund decal skin for PS4 Slim Console and two ..
$23.00
Bright stars decal skin for PS4 Slim Console and two contr..
Bright stars decal skin for PS4 Slim Console and two contr..
$23.00
Call of duty black ops 2 decal skin for PS4 Slim Console a..
Call of duty black ops 2 decal skin for PS4 Slim Console a..
$23.00
Call of duty black ops 2 decal skin for PS4 Slim Console a..
Call of duty black ops 2 decal skin for PS4 Slim Console a..
$23.00
Call of duty black ops 2 decal skin for PS4 Slim Console a..
Call of duty black ops 2 decal skin for PS4 Slim Console a..
$23.00
Call of duty black ops 3 decal skin for PS4 Slim Console a..
Call of duty black ops 3 decal skin for PS4 Slim Console a..
$23.00
Call of duty black ops 3 decal skin for PS4 Slim Console a..
Call of duty black ops 3 decal skin for PS4 Slim Console a..
$23.00
Call of duty black ops 3 decal skin for PS4 Slim Console a..
Call of duty black ops 3 decal skin for PS4 Slim Console a..
$23.00
Call of duty black ops 3 decal skin for PS4 Slim Console a..
Call of duty black ops 3 decal skin for PS4 Slim Console a..
$23.00
Call of duty black ops 3 decal skin for PS4 Slim Console a..
Call of duty black ops 3 decal skin for PS4 Slim Console a..
$23.00
Call of duty black ops 3 decal skin for PS4 Slim Console a..
Call of duty black ops 3 decal skin for PS4 Slim Console a..
$23.00
Call of Duty black ops 3 decal skin for PS4 Slim Console a..
Call of Duty black ops 3 decal skin for PS4 Slim Console a..
$23.00
Call of Duty black ops 3 decal skin for PS4 Slim Console a..
Call of Duty black ops 3 decal skin for PS4 Slim Console a..
$23.00
Call of Duty black ops 3 decal skin for PS4 Slim Console a..
Call of Duty black ops 3 decal skin for PS4 Slim Console a..
$23.00
Call of duty black ops decal skin for PS4 Slim Console and..
Call of duty black ops decal skin for PS4 Slim Console and..
$23.00
Call of duty Ghosts decal skin for PS4 Slim Console and tw..
Call of duty Ghosts decal skin for PS4 Slim Console and tw..
$23.00
Call of Duty infinite warfare decal skin for PS4 Slim Cons..
Call of Duty infinite warfare decal skin for PS4 Slim Cons..
$23.00
Call of Duty infinite warfare decal skin for PS4 Slim Cons..
Call of Duty infinite warfare decal skin for PS4 Slim Cons..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i