Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skin's Store
Assassins Creed decal skin for PS4 Slim Console and two co..
Assassins Creed decal skin for PS4 Slim Console and two co..
$23.00
Assassins Creed decal skin for PS4 Slim Console and two co..
Assassins Creed decal skin for PS4 Slim Console and two co..
$23.00
Assassins Creed decal skin for PS4 Slim Console and two co..
Assassins Creed decal skin for PS4 Slim Console and two co..
$23.00
Assassins Creed decal skin for PS4 Slim Console and two co..
Assassins Creed decal skin for PS4 Slim Console and two co..
$23.00
Assassins Creed Unity decal skin for PS4 Slim Console and ..
Assassins Creed Unity decal skin for PS4 Slim Console and ..
$23.00
Doctor Strange decal skin for PS4 Slim Console and two con..
Doctor Strange decal skin for PS4 Slim Console and two con..
$23.00
Doctor Strange decal skin for PS4 Slim Console and two con..
Doctor Strange decal skin for PS4 Slim Console and two con..
$23.00
Doctor Strange decal skin for PS4 Slim Console and two con..
Doctor Strange decal skin for PS4 Slim Console and two con..
$23.00
Doctor Strange decal skin for PS4 Slim Console and two con..
Doctor Strange decal skin for PS4 Slim Console and two con..
$23.00
Doctor Strange decal skin for PS4 Slim Console and two con..
Doctor Strange decal skin for PS4 Slim Console and two con..
$23.00
Doctor Strange decal skin for PS4 Slim Console and two con..
Doctor Strange decal skin for PS4 Slim Console and two con..
$23.00
Batman Arkham Origins decal skin for PS4 Slim Console and ..
Batman Arkham Origins decal skin for PS4 Slim Console and ..
$23.00
Isrel's Flag decal skin for PS4 Slim Console and two contr..
Isrel's Flag decal skin for PS4 Slim Console and two contr..
$23.00
Battlefield 1 decal skin for PS4 Slim Console and two cont..
Battlefield 1 decal skin for PS4 Slim Console and two cont..
$23.00
Batman decal skin for PS4 Slim Console and two controllers
Batman decal skin for PS4 Slim Console and two controllers
$23.00
Chelsa Football Club decal skin for PS4 Slim Console and t..
Chelsa Football Club decal skin for PS4 Slim Console and t..
$23.00
Batman V Superman decal skin for PS4 Slim Console and two ..
Batman V Superman decal skin for PS4 Slim Console and two ..
$23.00
Captain America decal skin for PS4 Slim Console and two co..
Captain America decal skin for PS4 Slim Console and two co..
$23.00
Manchester United decal skin for PS4 Slim Console and two ..
Manchester United decal skin for PS4 Slim Console and two ..
$23.00
Manchester United decal skin for PS4 Slim Console and two ..
Manchester United decal skin for PS4 Slim Console and two ..
$23.00
Houston Texans decal skin for PS4 Slim Console and two con..
Houston Texans decal skin for PS4 Slim Console and two con..
$23.00
Barcelona vs atletico madrid decal skin for PS4 Slim Conso..
Barcelona vs atletico madrid decal skin for PS4 Slim Conso..
$23.00
Titanfall 2 decal skin for PS4 Slim Console and two contro..
Titanfall 2 decal skin for PS4 Slim Console and two contro..
$23.00
Titanfall decal skin for PS4 Slim Console and two controll..
Titanfall decal skin for PS4 Slim Console and two controll..
$23.00
PS4 originals Wallpaper decal skin for PS4 Slim Console an..
PS4 originals Wallpaper decal skin for PS4 Slim Console an..
$23.00
Asiimov decal skin for PS4 Slim Console and two controllers
Asiimov decal skin for PS4 Slim Console and two controllers
$23.00
Titanfall decal skin for PS4 Slim Console and two controll..
Titanfall decal skin for PS4 Slim Console and two controll..
$23.00
Titanfall decal skin for PS4 Slim Console and two controll..
Titanfall decal skin for PS4 Slim Console and two controll..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i