Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skin's Store
Naruto Shippuden decal skin for PS4 Slim Console and two c..
Naruto Shippuden decal skin for PS4 Slim Console and two c..
$23.00
Naruto decal skin for PS4 Slim Console and two controllers
Naruto decal skin for PS4 Slim Console and two controllers
$23.00
Naruto decal skin for PS4 Slim Console and two controllers
Naruto decal skin for PS4 Slim Console and two controllers
$23.00
Mustafa Kemal Atat�rk decal skin for PS4 Slim Console and ..
Mustafa Kemal Atat�rk decal skin for PS4 Slim Console and ..
$23.00
Mortal Kombat decal skin for PS4 Slim Console and two cont..
Mortal Kombat decal skin for PS4 Slim Console and two cont..
$23.00
Mortal Kombat decal skin for PS4 Slim Console and two cont..
Mortal Kombat decal skin for PS4 Slim Console and two cont..
$23.00
Mobile Suit Tune decal skin for PS4 Slim Console and two c..
Mobile Suit Tune decal skin for PS4 Slim Console and two c..
$23.00
Minecraft decal skin for PS4 Slim Console and two controll..
Minecraft decal skin for PS4 Slim Console and two controll..
$23.00
Michael jordan decal skin for PS4 Slim Console and two con..
Michael jordan decal skin for PS4 Slim Console and two con..
$23.00
Metro Last Light decal skin for PS4 Slim Console and two c..
Metro Last Light decal skin for PS4 Slim Console and two c..
$23.00
Metal Gear Solid decal skin for PS4 Slim Console and two c..
Metal Gear Solid decal skin for PS4 Slim Console and two c..
$23.00
Messi Barcelona decal skin for PS4 Slim Console and two co..
Messi Barcelona decal skin for PS4 Slim Console and two co..
$23.00
Manchester United decal skin for PS4 Slim Console and two ..
Manchester United decal skin for PS4 Slim Console and two ..
$23.00
Manchester United decal skin for PS4 Slim Console and two ..
Manchester United decal skin for PS4 Slim Console and two ..
$23.00
Manchester United decal skin for PS4 Slim Console and two ..
Manchester United decal skin for PS4 Slim Console and two ..
$23.00
Manchester United decal skin for PS4 Slim Console and two ..
Manchester United decal skin for PS4 Slim Console and two ..
$23.00
Manchester United decal skin for PS4 Slim Console and two ..
Manchester United decal skin for PS4 Slim Console and two ..
$23.00
Manchester United decal skin for PS4 Slim Console and two ..
Manchester United decal skin for PS4 Slim Console and two ..
$23.00
Manchester United decal skin for PS4 Slim Console and two ..
Manchester United decal skin for PS4 Slim Console and two ..
$23.00
Manchester United decal skin for PS4 Slim Console and two ..
Manchester United decal skin for PS4 Slim Console and two ..
$23.00
Manchester United decal skin for PS4 Slim Console and two ..
Manchester United decal skin for PS4 Slim Console and two ..
$23.00
Manchester United decal skin for PS4 Slim Console and two ..
Manchester United decal skin for PS4 Slim Console and two ..
$23.00
Manchester City FC decal skin for PS4 Slim Console and two..
Manchester City FC decal skin for PS4 Slim Console and two..
$23.00
Liverpool Football Club decal skin for PS4 Slim Console an..
Liverpool Football Club decal skin for PS4 Slim Console an..
$23.00
Liverpool Football Club decal skin for PS4 Slim Console an..
Liverpool Football Club decal skin for PS4 Slim Console an..
$23.00
Leicester City decal skin for PS4 Slim Console and two con..
Leicester City decal skin for PS4 Slim Console and two con..
$23.00
Lamborghini Hurac�n decal skin for PS4 Slim Console and tw..
Lamborghini Hurac�n decal skin for PS4 Slim Console and tw..
$23.00
KV Mechelen decal skin for PS4 Slim Console and two contro..
KV Mechelen decal skin for PS4 Slim Console and two contro..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i