Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skin's Store 2
Rilakkuma decal skin for PS4 Slim Console and two controll..
Rilakkuma decal skin for PS4 Slim Console and two controll..
$23.00
Rilakkuma decal skin for PS4 Slim Console and two controll..
Rilakkuma decal skin for PS4 Slim Console and two controll..
$23.00
Hello Kitty decal skin for PS4 Slim Console and two contro..
Hello Kitty decal skin for PS4 Slim Console and two contro..
$23.00
Hello Kitty decal skin for PS4 Slim Console and two contro..
Hello Kitty decal skin for PS4 Slim Console and two contro..
$23.00
Absolut Vodka decal skin for PS4 Slim Console and two cont..
Absolut Vodka decal skin for PS4 Slim Console and two cont..
$23.00
Lebron James decal skin for PS4 Slim Console and two contr..
Lebron James decal skin for PS4 Slim Console and two contr..
$23.00
Guardians of the Galaxy decal skin for PS4 Slim Console an..
Guardians of the Galaxy decal skin for PS4 Slim Console an..
$23.00
Guardians of the Galaxy decal skin for PS4 Slim Console an..
Guardians of the Galaxy decal skin for PS4 Slim Console an..
$23.00
Guardians of the Galaxy decal skin for PS4 Slim Console an..
Guardians of the Galaxy decal skin for PS4 Slim Console an..
$23.00
Guardians of the Galaxy decal skin for PS4 Slim Console an..
Guardians of the Galaxy decal skin for PS4 Slim Console an..
$23.00
Guardians of the Galaxy decal skin for PS4 Slim Console an..
Guardians of the Galaxy decal skin for PS4 Slim Console an..
$23.00
Batman decal skin for PS4 Slim Console and two controllers
Batman decal skin for PS4 Slim Console and two controllers
$23.00
Naruto vs sasuke 4k decal skin for PS4 Slim Console and tw..
Naruto vs sasuke 4k decal skin for PS4 Slim Console and tw..
$23.00
Barcelona Real Mardrid decal skin for PS4 Slim Console and..
Barcelona Real Mardrid decal skin for PS4 Slim Console and..
$23.00
Assassin's Creed chronicles decal skin for PS4 Slim Consol..
Assassin's Creed chronicles decal skin for PS4 Slim Consol..
$23.00
Monster Energy decal skin for PS4 Slim Console and two con..
Monster Energy decal skin for PS4 Slim Console and two con..
$23.00
Black weed decal skin for PS4 Slim Console and two control..
Black weed decal skin for PS4 Slim Console and two control..
$23.00
Batman decal skin for PS4 Slim Console and two controllers
Batman decal skin for PS4 Slim Console and two controllers
$23.00
Naruto decal skin for PS4 Slim Console and two controllers
Naruto decal skin for PS4 Slim Console and two controllers
$23.00
Nier Automata decal skin for PS4 Slim Console and two cont..
Nier Automata decal skin for PS4 Slim Console and two cont..
$23.00
Nier Automata decal skin for PS4 Slim Console and two cont..
Nier Automata decal skin for PS4 Slim Console and two cont..
$23.00
Nier Automata decal skin for PS4 Slim Console and two cont..
Nier Automata decal skin for PS4 Slim Console and two cont..
$23.00
Nier Automata decal skin for PS4 Slim Console and two cont..
Nier Automata decal skin for PS4 Slim Console and two cont..
$23.00
Fire weeds decal skin for PS4 Slim Console and two control..
Fire weeds decal skin for PS4 Slim Console and two control..
$23.00
Mass Effect decal skin for PS4 Slim Console and two contro..
Mass Effect decal skin for PS4 Slim Console and two contro..
$23.00
Mass Effect decal skin for PS4 Slim Console and two contro..
Mass Effect decal skin for PS4 Slim Console and two contro..
$23.00
Mass Effect decal skin for PS4 Slim Console and two contro..
Mass Effect decal skin for PS4 Slim Console and two contro..
$23.00
Mass Effect decal skin for PS4 Slim Console and two contro..
Mass Effect decal skin for PS4 Slim Console and two contro..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i