Product Added to your Cart
x

-------- OR --------

Default
CroatiaFranceHebrewHungaryVietnameseGreeceCzech RepublicDenmarkRomaniaFinland
USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
PS4 Slim Skin's Store 2
500 product(s) found for "PS4 Slim Skin's Store 2"
One Punch Man decal skin for..
PS4 Slim Skin's Store 2
One Punch Man decal skin for..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Harley Quinn decal skin for ..
PS4 Slim Skin's Store 2
Harley Quinn decal skin for ..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Nioh decal skin for PS4 Slim..
PS4 Slim Skin's Store 2
Nioh decal skin for PS4 Slim..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Nioh decal skin for PS4 Slim..
PS4 Slim Skin's Store 2
Nioh decal skin for PS4 Slim..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Nioh decal skin for PS4 Slim..
PS4 Slim Skin's Store 2
Nioh decal skin for PS4 Slim..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Liverpool decal skin for PS4..
PS4 Slim Skin's Store 2
Liverpool decal skin for PS4..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
For Honor decal skin for PS4..
PS4 Slim Skin's Store 2
For Honor decal skin for PS4..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
For Honor decal skin for PS4..
PS4 Slim Skin's Store 2
For Honor decal skin for PS4..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Batman Arkham Knight decal s..
PS4 Slim Skin's Store 2
Batman Arkham Knight decal s..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Final fantasy 13 serah decal..
PS4 Slim Skin's Store 2
Final fantasy 13 serah decal..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Deadpool decal skin for PS4 ..
PS4 Slim Skin's Store 2
Deadpool decal skin for PS4 ..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Gucci decal skin for PS4 Sli..
PS4 Slim Skin's Store 2
Gucci decal skin for PS4 Sli..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Floral carbon art decal skin..
PS4 Slim Skin's Store 2
Floral carbon art decal skin..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Re zero decal skin for PS4 S..
PS4 Slim Skin's Store 2
Re zero decal skin for PS4 S..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Re zero decal skin for PS4 S..
PS4 Slim Skin's Store 2
Re zero decal skin for PS4 S..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Re zero decal skin for PS4 S..
PS4 Slim Skin's Store 2
Re zero decal skin for PS4 S..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Crash Bandicoot decal skin f..
PS4 Slim Skin's Store 2
Crash Bandicoot decal skin f..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Uncharted decal skin for PS4..
PS4 Slim Skin's Store 2
Uncharted decal skin for PS4..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Call of Duty Black ops 3 dec..
PS4 Slim Skin's Store 2
Call of Duty Black ops 3 dec..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Nioh decal skin for PS4 Slim..
PS4 Slim Skin's Store 2
Nioh decal skin for PS4 Slim..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Nioh decal skin for PS4 Slim..
PS4 Slim Skin's Store 2
Nioh decal skin for PS4 Slim..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Kingdom Hearts HD decal skin..
PS4 Slim Skin's Store 2
Kingdom Hearts HD decal skin..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Resident Evil Biohazard deca..
PS4 Slim Skin's Store 2
Resident Evil Biohazard deca..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Meka decal skin for PS4 Slim..
PS4 Slim Skin's Store 2
Meka decal skin for PS4 Slim..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Anime decal skin for PS4 Sli..
PS4 Slim Skin's Store 2
Anime decal skin for PS4 Sli..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Emoji decal skin for PS4 Sli..
PS4 Slim Skin's Store 2
Emoji decal skin for PS4 Sli..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Persona 5 decal skin for PS4..
PS4 Slim Skin's Store 2
Persona 5 decal skin for PS4..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Deutschland decal skin for P..
PS4 Slim Skin's Store 2
Deutschland decal skin for P..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i