Product Added to your Cart
x

-------- OR --------

Default
CroatiaFranceHebrewHungaryVietnameseGreeceCzech RepublicDenmarkRomaniaFinland
USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
PS4 Slim Skin's Store 2
500 product(s) found for "PS4 Slim Skin's Store 2"
Guardians of the Galaxy 2 de..
PS4 Slim Skin's Store 2
Guardians of the Galaxy 2 de..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Guardians of the Galaxy 2 de..
PS4 Slim Skin's Store 2
Guardians of the Galaxy 2 de..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Guardians of the Galaxy 2 de..
PS4 Slim Skin's Store 2
Guardians of the Galaxy 2 de..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Guardians of the Galaxy 2 de..
PS4 Slim Skin's Store 2
Guardians of the Galaxy 2 de..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Guardians of the Galaxy 2 de..
PS4 Slim Skin's Store 2
Guardians of the Galaxy 2 de..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Guardians of the Galaxy deca..
PS4 Slim Skin's Store 2
Guardians of the Galaxy deca..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Guardians of the Galaxy deca..
PS4 Slim Skin's Store 2
Guardians of the Galaxy deca..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Guardians of the Galaxy deca..
PS4 Slim Skin's Store 2
Guardians of the Galaxy deca..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Guardians of the Galaxy deca..
PS4 Slim Skin's Store 2
Guardians of the Galaxy deca..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Guardians of the Galaxy deca..
PS4 Slim Skin's Store 2
Guardians of the Galaxy deca..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Gucci decal skin for PS4 Sli..
PS4 Slim Skin's Store 2
Gucci decal skin for PS4 Sli..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Gwent Challenger decal skin ..
PS4 Slim Skin's Store 2
Gwent Challenger decal skin ..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Gwent Challenger decal skin ..
PS4 Slim Skin's Store 2
Gwent Challenger decal skin ..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Gwent The Witcher card game ..
PS4 Slim Skin's Store 2
Gwent The Witcher card game ..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Harley Quinn decal skin for ..
PS4 Slim Skin's Store 2
Harley Quinn decal skin for ..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Harley Quinn decal skin for ..
PS4 Slim Skin's Store 2
Harley Quinn decal skin for ..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Hatsune miku kimono decal sk..
PS4 Slim Skin's Store 2
Hatsune miku kimono decal sk..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Hello Kitty decal skin for P..
PS4 Slim Skin's Store 2
Hello Kitty decal skin for P..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Hello Kitty decal skin for P..
PS4 Slim Skin's Store 2
Hello Kitty decal skin for P..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Hello Kitty decal skin for P..
PS4 Slim Skin's Store 2
Hello Kitty decal skin for P..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Hello Kitty decal skin for P..
PS4 Slim Skin's Store 2
Hello Kitty decal skin for P..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Hexagon pattern decal skin f..
PS4 Slim Skin's Store 2
Hexagon pattern decal skin f..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Hey Look its me decal skin f..
PS4 Slim Skin's Store 2
Hey Look its me decal skin f..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Horizon Zero Dawn decal skin..
PS4 Slim Skin's Store 2
Horizon Zero Dawn decal skin..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Horizon Zero Dawn decal skin..
PS4 Slim Skin's Store 2
Horizon Zero Dawn decal skin..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Horizon Zero Dawn decal skin..
PS4 Slim Skin's Store 2
Horizon Zero Dawn decal skin..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Horizon Zero Dawn decal skin..
PS4 Slim Skin's Store 2
Horizon Zero Dawn decal skin..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Horizon Zero Dawn decal skin..
PS4 Slim Skin's Store 2
Horizon Zero Dawn decal skin..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i