Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skin's Store 3
Paris Saint Germain FC decal skin for PS4 Slim Console and..
Paris Saint Germain FC decal skin for PS4 Slim Console and..
$23.00
Paris Saint-Germain decal skin for PS4 Slim Console and tw..
Paris Saint-Germain decal skin for PS4 Slim Console and tw..
$23.00
PES 2018 decal skin for PS4 Slim Console and two controllers
PES 2018 decal skin for PS4 Slim Console and two controllers
$23.00
PES 2018 decal skin for PS4 Slim Console and two controllers
PES 2018 decal skin for PS4 Slim Console and two controllers
$23.00
Pink Color decal skin for PS4 Slim Console and two control..
Pink Color decal skin for PS4 Slim Console and two control..
$23.00
Plants vs Zombies GW2 decal skin for PS4 Slim Console and ..
Plants vs Zombies GW2 decal skin for PS4 Slim Console and ..
$23.00
Plants vs Zombies GW2 decal skin for PS4 Slim Console and ..
Plants vs Zombies GW2 decal skin for PS4 Slim Console and ..
$23.00
Plants vs Zombies GW2 decal skin for PS4 Slim Console and ..
Plants vs Zombies GW2 decal skin for PS4 Slim Console and ..
$23.00
Plants vs Zombies GW2 decal skin for PS4 Slim Console and ..
Plants vs Zombies GW2 decal skin for PS4 Slim Console and ..
$23.00
Plants vs Zombies My GW2 Hero decal skin for PS4 Slim Cons..
Plants vs Zombies My GW2 Hero decal skin for PS4 Slim Cons..
$23.00
Playerunknown's Battlegrounds decal skin for PS4 Slim Cons..
Playerunknown's Battlegrounds decal skin for PS4 Slim Cons..
$23.00
Playerunknown's Battlegrounds decal skin for PS4 Slim Cons..
Playerunknown's Battlegrounds decal skin for PS4 Slim Cons..
$23.00
Playstation Icon decal skin for PS4 Slim Console and two c..
Playstation Icon decal skin for PS4 Slim Console and two c..
$23.00
Playstation Logo decal skin for PS4 Slim Console and two c..
Playstation Logo decal skin for PS4 Slim Console and two c..
$23.00
Prismatic Happy Family Clipart decal skin for PS4 Slim Con..
Prismatic Happy Family Clipart decal skin for PS4 Slim Con..
$23.00
PS4 Button Print decal skin for PS4 Slim Console and two c..
PS4 Button Print decal skin for PS4 Slim Console and two c..
$23.00
Punisher Skull decal skin for PS4 Slim Console and two con..
Punisher Skull decal skin for PS4 Slim Console and two con..
$23.00
Punk forever decal skin for PS4 Slim Console and two contr..
Punk forever decal skin for PS4 Slim Console and two contr..
$23.00
Punk Guitar decal skin for PS4 Slim Console and two contro..
Punk Guitar decal skin for PS4 Slim Console and two contro..
$23.00
Punk Guitar decal skin for PS4 Slim Console and two contro..
Punk Guitar decal skin for PS4 Slim Console and two contro..
$23.00
Punk outlaw decal skin for PS4 Slim Console and two contro..
Punk outlaw decal skin for PS4 Slim Console and two contro..
$23.00
Punk rock decal skin for PS4 Slim Console and two controll..
Punk rock decal skin for PS4 Slim Console and two controll..
$23.00
Punk rock decal skin for PS4 Slim Console and two controll..
Punk rock decal skin for PS4 Slim Console and two controll..
$23.00
Punk rock decal skin for PS4 Slim Console and two controll..
Punk rock decal skin for PS4 Slim Console and two controll..
$23.00
Punk rock decal skin for PS4 Slim Console and two controll..
Punk rock decal skin for PS4 Slim Console and two controll..
$23.00
Punk rock decal skin for PS4 Slim Console and two controll..
Punk rock decal skin for PS4 Slim Console and two controll..
$23.00
Punk rock decal skin for PS4 Slim Console and two controll..
Punk rock decal skin for PS4 Slim Console and two controll..
$23.00
Punk rock decal skin for PS4 Slim Console and two controll..
Punk rock decal skin for PS4 Slim Console and two controll..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i