Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skin's Store 3
Blue Flame decal skin for PS4 Slim Console and two control..
Blue Flame decal skin for PS4 Slim Console and two control..
$23.00
Boston Celtics decal skin for PS4 Slim Console and two con..
Boston Celtics decal skin for PS4 Slim Console and two con..
$23.00
Breaking Bad decal skin for PS4 Slim Console and two contr..
Breaking Bad decal skin for PS4 Slim Console and two contr..
$23.00
Brick wall decal skin for PS4 Slim Console and two control..
Brick wall decal skin for PS4 Slim Console and two control..
$23.00
Brick wall print decal skin for PS4 Slim Console and two c..
Brick wall print decal skin for PS4 Slim Console and two c..
$23.00
Bright Moon decal skin for PS4 Slim Console and two contro..
Bright Moon decal skin for PS4 Slim Console and two contro..
$23.00
Burning Tiger decal skin for PS4 Slim Console and two cont..
Burning Tiger decal skin for PS4 Slim Console and two cont..
$23.00
Bursting Moon decal skin for PS4 Slim Console and two cont..
Bursting Moon decal skin for PS4 Slim Console and two cont..
$23.00
Bursting Moon decal skin for PS4 Slim Console and two cont..
Bursting Moon decal skin for PS4 Slim Console and two cont..
$23.00
Call of Duty World at War decal skin for PS4 Slim Console ..
Call of Duty World at War decal skin for PS4 Slim Console ..
$23.00
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
$23.00
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
$23.00
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
$23.00
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
$23.00
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
$23.00
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
$23.00
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
$23.00
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
$23.00
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
$23.00
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
$23.00
Cannabis leaf decal skin for PS4 Slim Console and two cont..
Cannabis leaf decal skin for PS4 Slim Console and two cont..
$23.00
Captain America Civil War decal skin for PS4 Slim Console ..
Captain America Civil War decal skin for PS4 Slim Console ..
$23.00
Car Print decal skin for PS4 Slim Console and two controll..
Car Print decal skin for PS4 Slim Console and two controll..
$23.00
Chelsea FC decal skin for PS4 Slim Console and two control..
Chelsea FC decal skin for PS4 Slim Console and two control..
$23.00
Chinese Revolution decal skin for PS4 Slim Console and two..
Chinese Revolution decal skin for PS4 Slim Console and two..
$23.00
Chinese Revolution decal skin for PS4 Slim Console and two..
Chinese Revolution decal skin for PS4 Slim Console and two..
$23.00
Chinese Revolution decal skin for PS4 Slim Console and two..
Chinese Revolution decal skin for PS4 Slim Console and two..
$23.00
Chinese Revolution decal skin for PS4 Slim Console and two..
Chinese Revolution decal skin for PS4 Slim Console and two..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i