Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skin's Store 3
Boston Celtics decal skin for PS4 Slim Console and two con..
Boston Celtics decal skin for PS4 Slim Console and two con..
$23.00
Oklahoma City Thunder decal skin for PS4 Slim Console and ..
Oklahoma City Thunder decal skin for PS4 Slim Console and ..
$23.00
San Antonio Spurs decal skin for PS4 Slim Console and two ..
San Antonio Spurs decal skin for PS4 Slim Console and two ..
$23.00
Cleveland Cavaliers decal skin for PS4 Slim Console and tw..
Cleveland Cavaliers decal skin for PS4 Slim Console and tw..
$23.00
Wooden Board decal skin for PS4 Slim Console and two contr..
Wooden Board decal skin for PS4 Slim Console and two contr..
$23.00
Sonic Forces decal skin for PS4 Slim Console and two contr..
Sonic Forces decal skin for PS4 Slim Console and two contr..
$23.00
Playerunknown's Battlegrounds decal skin for PS4 Slim Cons..
Playerunknown's Battlegrounds decal skin for PS4 Slim Cons..
$23.00
Playerunknown's Battlegrounds decal skin for PS4 Slim Cons..
Playerunknown's Battlegrounds decal skin for PS4 Slim Cons..
$23.00
Terraria decal skin for PS4 Slim Console and two controllers
Terraria decal skin for PS4 Slim Console and two controllers
$23.00
Monster Hunter World decal skin for PS4 Slim Console and t..
Monster Hunter World decal skin for PS4 Slim Console and t..
$23.00
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
$23.00
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
$23.00
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
$23.00
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
$23.00
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
$23.00
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
$23.00
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
$23.00
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
$23.00
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
Call of Duty WW2 decal skin for PS4 Slim Console and two c..
$23.00
Classic Design decal skin for PS4 Slim Console and two con..
Classic Design decal skin for PS4 Slim Console and two con..
$23.00
Need For Speed decal skin for PS4 Slim Console and two con..
Need For Speed decal skin for PS4 Slim Console and two con..
$23.00
Assassin's Creed Syndicate decal skin for PS4 Slim Console..
Assassin's Creed Syndicate decal skin for PS4 Slim Console..
$23.00
Dragon Ball Z decal skin for PS4 Slim Console and two cont..
Dragon Ball Z decal skin for PS4 Slim Console and two cont..
$23.00
Gran Turismo Sport decal skin for PS4 Slim Console and two..
Gran Turismo Sport decal skin for PS4 Slim Console and two..
$23.00
Gran Turismo Sport decal skin for PS4 Slim Console and two..
Gran Turismo Sport decal skin for PS4 Slim Console and two..
$23.00
Gran Turismo Sport decal skin for PS4 Slim Console and two..
Gran Turismo Sport decal skin for PS4 Slim Console and two..
$23.00
Gran Turismo Sport decal skin for PS4 Slim Console and two..
Gran Turismo Sport decal skin for PS4 Slim Console and two..
$23.00
Star Wars decal skin for PS4 Slim Console and two controll..
Star Wars decal skin for PS4 Slim Console and two controll..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i