Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skin's Store 4
Battlefield 5 decal skin for PS4 Slim Console and two cont..
Battlefield 5 decal skin for PS4 Slim Console and two cont..
$23.00
Battlefield 5 world war decal skin for PS4 Slim Console an..
Battlefield 5 world war decal skin for PS4 Slim Console an..
$23.00
Black 3D decal skin for PS4 Slim Console and two controllers
Black 3D decal skin for PS4 Slim Console and two controllers
$23.00
Black Panther decal skin for PS4 Slim Console and two cont..
Black Panther decal skin for PS4 Slim Console and two cont..
$23.00
Black Panther decal skin for PS4 Slim Console and two cont..
Black Panther decal skin for PS4 Slim Console and two cont..
$23.00
Black Panther decal skin for PS4 Slim Console and two cont..
Black Panther decal skin for PS4 Slim Console and two cont..
$23.00
Black Panther decal skin for PS4 Slim Console and two cont..
Black Panther decal skin for PS4 Slim Console and two cont..
$23.00
Black Panther decal skin for PS4 Slim Console and two cont..
Black Panther decal skin for PS4 Slim Console and two cont..
$23.00
Black Panther decal skin for PS4 Slim Console and two cont..
Black Panther decal skin for PS4 Slim Console and two cont..
$23.00
Black Panther decal skin for PS4 Slim Console and two cont..
Black Panther decal skin for PS4 Slim Console and two cont..
$23.00
Black Panther decal skin for PS4 Slim Console and two cont..
Black Panther decal skin for PS4 Slim Console and two cont..
$23.00
Black Panther decal skin for PS4 Slim Console and two cont..
Black Panther decal skin for PS4 Slim Console and two cont..
$23.00
Black Panther decal skin for PS4 Slim Console and two cont..
Black Panther decal skin for PS4 Slim Console and two cont..
$23.00
Bloodstained Ritual of the Night decal skin for PS4 Slim C..
Bloodstained Ritual of the Night decal skin for PS4 Slim C..
$23.00
Bloodstained Ritual of the Night decal skin for PS4 Slim C..
Bloodstained Ritual of the Night decal skin for PS4 Slim C..
$23.00
Bloodstained Ritual of the Night decal skin for PS4 Slim C..
Bloodstained Ritual of the Night decal skin for PS4 Slim C..
$23.00
Bloodstained Ritual of the Night decal skin for PS4 Slim C..
Bloodstained Ritual of the Night decal skin for PS4 Slim C..
$23.00
Bloodstained Ritual of the Night decal skin for PS4 Slim C..
Bloodstained Ritual of the Night decal skin for PS4 Slim C..
$23.00
Bloodstained Ritual of the Night decal skin for PS4 Slim C..
Bloodstained Ritual of the Night decal skin for PS4 Slim C..
$23.00
Bloodstained Ritual of the Night decal skin for PS4 Slim C..
Bloodstained Ritual of the Night decal skin for PS4 Slim C..
$23.00
Bloodstained Ritual of the Night decal skin for PS4 Slim C..
Bloodstained Ritual of the Night decal skin for PS4 Slim C..
$23.00
Bloodstained Ritual of the Night decal skin for PS4 Slim C..
Bloodstained Ritual of the Night decal skin for PS4 Slim C..
$23.00
Bloodstained Ritual of the Night decal skin for PS4 Slim C..
Bloodstained Ritual of the Night decal skin for PS4 Slim C..
$23.00
Boston Celtics decal skin for PS4 Slim Console and two con..
Boston Celtics decal skin for PS4 Slim Console and two con..
$23.00
Boston Celtics decal skin for PS4 Slim Console and two con..
Boston Celtics decal skin for PS4 Slim Console and two con..
$23.00
Brazil national FT decal skin for PS4 Slim Console and two..
Brazil national FT decal skin for PS4 Slim Console and two..
$23.00
Brazilian Football Confederation decal skin for PS4 Slim C..
Brazilian Football Confederation decal skin for PS4 Slim C..
$23.00
Brazilian Football Confederation decal skin for PS4 Slim C..
Brazilian Football Confederation decal skin for PS4 Slim C..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i