Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skin's Store 4
Kingdom Come Deliverance decal skin for PS4 Slim Console a..
Kingdom Come Deliverance decal skin for PS4 Slim Console a..
$23.00
Kingdom Come Deliverance decal skin for PS4 Slim Console a..
Kingdom Come Deliverance decal skin for PS4 Slim Console a..
$23.00
Kingdom Come Deliverance decal skin for PS4 Slim Console a..
Kingdom Come Deliverance decal skin for PS4 Slim Console a..
$23.00
Kingdom Come Deliverance decal skin for PS4 Slim Console a..
Kingdom Come Deliverance decal skin for PS4 Slim Console a..
$23.00
Kingdom Come Deliverance decal skin for PS4 Slim Console a..
Kingdom Come Deliverance decal skin for PS4 Slim Console a..
$23.00
Avengers infinity war decal skin for PS4 Slim Console and ..
Avengers infinity war decal skin for PS4 Slim Console and ..
$23.00
Avengers infinity war decal skin for PS4 Slim Console and ..
Avengers infinity war decal skin for PS4 Slim Console and ..
$23.00
Avengers infinity war decal skin for PS4 Slim Console and ..
Avengers infinity war decal skin for PS4 Slim Console and ..
$23.00
Black Panther decal skin for PS4 Slim Console and two cont..
Black Panther decal skin for PS4 Slim Console and two cont..
$23.00
Black Panther decal skin for PS4 Slim Console and two cont..
Black Panther decal skin for PS4 Slim Console and two cont..
$23.00
Fairy Tail decal skin for PS4 Slim Console and two control..
Fairy Tail decal skin for PS4 Slim Console and two control..
$23.00
Fairy Tail decal skin for PS4 Slim Console and two control..
Fairy Tail decal skin for PS4 Slim Console and two control..
$23.00
Fairy Tail decal skin for PS4 Slim Console and two control..
Fairy Tail decal skin for PS4 Slim Console and two control..
$23.00
Fairy Tail decal skin for PS4 Slim Console and two control..
Fairy Tail decal skin for PS4 Slim Console and two control..
$23.00
Fairy Tail decal skin for PS4 Slim Console and two control..
Fairy Tail decal skin for PS4 Slim Console and two control..
$23.00
Fairy Tail decal skin for PS4 Slim Console and two control..
Fairy Tail decal skin for PS4 Slim Console and two control..
$23.00
Dying Light decal skin for PS4 Slim Console and two contro..
Dying Light decal skin for PS4 Slim Console and two contro..
$23.00
Dying Light decal skin for PS4 Slim Console and two contro..
Dying Light decal skin for PS4 Slim Console and two contro..
$23.00
Dying Light decal skin for PS4 Slim Console and two contro..
Dying Light decal skin for PS4 Slim Console and two contro..
$23.00
God of War 4 decal skin for PS4 Slim Console and two contr..
God of War 4 decal skin for PS4 Slim Console and two contr..
$23.00
God of War 4 decal skin for PS4 Slim Console and two contr..
God of War 4 decal skin for PS4 Slim Console and two contr..
$23.00
Skull Art decal skin for PS4 Slim Console and two controll..
Skull Art decal skin for PS4 Slim Console and two controll..
$23.00
Dark Souls decal skin for PS4 Slim Console and two control..
Dark Souls decal skin for PS4 Slim Console and two control..
$23.00
Dark Souls decal skin for PS4 Slim Console and two control..
Dark Souls decal skin for PS4 Slim Console and two control..
$23.00
Dark Souls decal skin for PS4 Slim Console and two control..
Dark Souls decal skin for PS4 Slim Console and two control..
$23.00
Dark Souls decal skin for PS4 Slim Console and two control..
Dark Souls decal skin for PS4 Slim Console and two control..
$23.00
Dark Souls decal skin for PS4 Slim Console and two control..
Dark Souls decal skin for PS4 Slim Console and two control..
$23.00
Dark Souls decal skin for PS4 Slim Console and two control..
Dark Souls decal skin for PS4 Slim Console and two control..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i