Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skin's Store 4
Knack 2 decal skin for PS4 Slim Console and two controllers
Knack 2 decal skin for PS4 Slim Console and two controllers
$23.00
Klay Thompson decal skin for PS4 Slim Console and two cont..
Klay Thompson decal skin for PS4 Slim Console and two cont..
$23.00
Kingdom Hearts decal skin for PS4 Slim Console and two con..
Kingdom Hearts decal skin for PS4 Slim Console and two con..
$23.00
Kingdom Hearts decal skin for PS4 Slim Console and two con..
Kingdom Hearts decal skin for PS4 Slim Console and two con..
$23.00
Kingdom Hearts 3 decal skin for PS4 Slim Console and two c..
Kingdom Hearts 3 decal skin for PS4 Slim Console and two c..
$23.00
Kingdom Hearts 3 decal skin for PS4 Slim Console and two c..
Kingdom Hearts 3 decal skin for PS4 Slim Console and two c..
$23.00
Kingdom Hearts 3 decal skin for PS4 Slim Console and two c..
Kingdom Hearts 3 decal skin for PS4 Slim Console and two c..
$23.00
Kingdom Come Deliverance decal skin for PS4 Slim Console a..
Kingdom Come Deliverance decal skin for PS4 Slim Console a..
$23.00
Kingdom Come Deliverance decal skin for PS4 Slim Console a..
Kingdom Come Deliverance decal skin for PS4 Slim Console a..
$23.00
Kingdom Come Deliverance decal skin for PS4 Slim Console a..
Kingdom Come Deliverance decal skin for PS4 Slim Console a..
$23.00
Kingdom Come Deliverance decal skin for PS4 Slim Console a..
Kingdom Come Deliverance decal skin for PS4 Slim Console a..
$23.00
Kingdom Come Deliverance decal skin for PS4 Slim Console a..
Kingdom Come Deliverance decal skin for PS4 Slim Console a..
$23.00
Kevin Garnett decal skin for PS4 Slim Console and two cont..
Kevin Garnett decal skin for PS4 Slim Console and two cont..
$23.00
Kevin Durant decal skin for PS4 Slim Console and two contr..
Kevin Durant decal skin for PS4 Slim Console and two contr..
$23.00
Kevin Durant decal skin for PS4 Slim Console and two contr..
Kevin Durant decal skin for PS4 Slim Console and two contr..
$23.00
Justin Bieber decal skin for PS4 Slim Console and two cont..
Justin Bieber decal skin for PS4 Slim Console and two cont..
$23.00
Jordan 23 decal skin for PS4 Slim Console and two controll..
Jordan 23 decal skin for PS4 Slim Console and two controll..
$23.00
Joker decal skin for PS4 Slim Console and two controllers
Joker decal skin for PS4 Slim Console and two controllers
$23.00
James Harden decal skin for PS4 Slim Console and two contr..
James Harden decal skin for PS4 Slim Console and two contr..
$23.00
James Harden decal skin for PS4 Slim Console and two contr..
James Harden decal skin for PS4 Slim Console and two contr..
$23.00
James Harden decal skin for PS4 Slim Console and two contr..
James Harden decal skin for PS4 Slim Console and two contr..
$23.00
Italy national FT decal skin for PS4 Slim Console and two ..
Italy national FT decal skin for PS4 Slim Console and two ..
$23.00
Houston Rockets decal skin for PS4 Slim Console and two co..
Houston Rockets decal skin for PS4 Slim Console and two co..
$23.00
Houston Rockets decal skin for PS4 Slim Console and two co..
Houston Rockets decal skin for PS4 Slim Console and two co..
$23.00
Houston Rockets decal skin for PS4 Slim Console and two co..
Houston Rockets decal skin for PS4 Slim Console and two co..
$23.00
Horizon Zero Dawn The Frozen Wilds decal skin for PS4 Slim..
Horizon Zero Dawn The Frozen Wilds decal skin for PS4 Slim..
$23.00
Horizon Zero Dawn decal skin for PS4 Slim Console and two ..
Horizon Zero Dawn decal skin for PS4 Slim Console and two ..
$23.00
Hokuto ga Gotoku decal skin for PS4 Slim Console and two c..
Hokuto ga Gotoku decal skin for PS4 Slim Console and two c..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i