Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skin's Store 5
Playerunknown's Battlegrounds decal skin for PS4 Slim Cons..
Playerunknown's Battlegrounds decal skin for PS4 Slim Cons..
$23.00
Playerunknown's Battlegrounds decal skin for PS4 Slim Cons..
Playerunknown's Battlegrounds decal skin for PS4 Slim Cons..
$23.00
Playerunknown's Battlegrounds decal skin for PS4 Slim Cons..
Playerunknown's Battlegrounds decal skin for PS4 Slim Cons..
$23.00
Playerunknown's Battlegrounds decal skin for PS4 Slim Cons..
Playerunknown's Battlegrounds decal skin for PS4 Slim Cons..
$23.00
Playerunknown's Battlegrounds decal skin for PS4 Slim Cons..
Playerunknown's Battlegrounds decal skin for PS4 Slim Cons..
$23.00
Playerunknown's Battlegrounds decal skin for PS4 Slim Cons..
Playerunknown's Battlegrounds decal skin for PS4 Slim Cons..
$23.00
PES 2019 decal skin for PS4 Slim Console and two controllers
PES 2019 decal skin for PS4 Slim Console and two controllers
$23.00
PES 2019 decal skin for PS4 Slim Console and two controllers
PES 2019 decal skin for PS4 Slim Console and two controllers
$23.00
PES 2019 decal skin for PS4 Slim Console and two controllers
PES 2019 decal skin for PS4 Slim Console and two controllers
$23.00
PES 2019 decal skin for PS4 Slim Console and two controllers
PES 2019 decal skin for PS4 Slim Console and two controllers
$23.00
PES 2019 decal skin for PS4 Slim Console and two controllers
PES 2019 decal skin for PS4 Slim Console and two controllers
$23.00
PES 2019 decal skin for PS4 Slim Console and two controllers
PES 2019 decal skin for PS4 Slim Console and two controllers
$23.00
PES 2019 decal skin for PS4 Slim Console and two controllers
PES 2019 decal skin for PS4 Slim Console and two controllers
$23.00
PES 2019 decal skin for PS4 Slim Console and two controllers
PES 2019 decal skin for PS4 Slim Console and two controllers
$23.00
PES 2019 decal skin for PS4 Slim Console and two controllers
PES 2019 decal skin for PS4 Slim Console and two controllers
$23.00
PES 2019 decal skin for PS4 Slim Console and two controllers
PES 2019 decal skin for PS4 Slim Console and two controllers
$23.00
PES 2019 decal skin for PS4 Slim Console and two controllers
PES 2019 decal skin for PS4 Slim Console and two controllers
$23.00
Pentagram design decal skin for PS4 Slim Console and two c..
Pentagram design decal skin for PS4 Slim Console and two c..
$23.00
Pentagram design decal skin for PS4 Slim Console and two c..
Pentagram design decal skin for PS4 Slim Console and two c..
$23.00
Pentagram design decal skin for PS4 Slim Console and two c..
Pentagram design decal skin for PS4 Slim Console and two c..
$23.00
PCB Board decal skin for PS4 Slim Console and two controll..
PCB Board decal skin for PS4 Slim Console and two controll..
$23.00
Painted Clipart decal skin for PS4 Slim Console and two co..
Painted Clipart decal skin for PS4 Slim Console and two co..
$23.00
Ortega maila decal skin for PS4 Slim Console and two contr..
Ortega maila decal skin for PS4 Slim Console and two contr..
$23.00
Orlando Magic decal skin for PS4 Slim Console and two cont..
Orlando Magic decal skin for PS4 Slim Console and two cont..
$23.00
Onepiece decal skin for PS4 Slim Console and two controllers
Onepiece decal skin for PS4 Slim Console and two controllers
$23.00
Onepiece decal skin for PS4 Slim Console and two controllers
Onepiece decal skin for PS4 Slim Console and two controllers
$23.00
One Piece decal skin for PS4 Slim Console and two controll..
One Piece decal skin for PS4 Slim Console and two controll..
$23.00
One Piece decal skin for PS4 Slim Console and two controll..
One Piece decal skin for PS4 Slim Console and two controll..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i