Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skin's Store 5
Galaxy Scene decal skin for PS4 Slim Console and two contr..
Galaxy Scene decal skin for PS4 Slim Console and two contr..
$23.00
Galaxy Scene decal skin for PS4 Slim Console and two contr..
Galaxy Scene decal skin for PS4 Slim Console and two contr..
$23.00
Galaxy Scene decal skin for PS4 Slim Console and two contr..
Galaxy Scene decal skin for PS4 Slim Console and two contr..
$23.00
Game of thrones decal skin for PS4 Slim Console and two co..
Game of thrones decal skin for PS4 Slim Console and two co..
$23.00
Green bay packers decal skin for PS4 Slim Console and two ..
Green bay packers decal skin for PS4 Slim Console and two ..
$23.00
Green Hulk decal skin for PS4 Slim Console and two control..
Green Hulk decal skin for PS4 Slim Console and two control..
$23.00
Grey Board decal skin for PS4 Slim Console and two control..
Grey Board decal skin for PS4 Slim Console and two control..
$23.00
Grim Reaper decal skin for PS4 Slim Console and two contro..
Grim Reaper decal skin for PS4 Slim Console and two contro..
$23.00
Harley Quinn decal skin for PS4 Slim Console and two contr..
Harley Quinn decal skin for PS4 Slim Console and two contr..
$23.00
Hello Kitty decal skin for PS4 Slim Console and two contro..
Hello Kitty decal skin for PS4 Slim Console and two contro..
$23.00
Hippie wallpaper decal skin for PS4 Slim Console and two c..
Hippie wallpaper decal skin for PS4 Slim Console and two c..
$23.00
Houston Astros decal skin for PS4 Slim Console and two con..
Houston Astros decal skin for PS4 Slim Console and two con..
$23.00
Jaya France Battlegrounds decal skin for PS4 Slim Console ..
Jaya France Battlegrounds decal skin for PS4 Slim Console ..
$23.00
Jaya France Battlegrounds decal skin for PS4 Slim Console ..
Jaya France Battlegrounds decal skin for PS4 Slim Console ..
$23.00
Jordan 23 decal skin for PS4 Slim Console and two controll..
Jordan 23 decal skin for PS4 Slim Console and two controll..
$23.00
Kingdom Hearts 3 decal skin for PS4 Slim Console and two c..
Kingdom Hearts 3 decal skin for PS4 Slim Console and two c..
$23.00
Kingdom Hearts 3 decal skin for PS4 Slim Console and two c..
Kingdom Hearts 3 decal skin for PS4 Slim Console and two c..
$23.00
Kingdom Hearts 3 decal skin for PS4 Slim Console and two c..
Kingdom Hearts 3 decal skin for PS4 Slim Console and two c..
$23.00
Kingdom Hearts 3 decal skin for PS4 Slim Console and two c..
Kingdom Hearts 3 decal skin for PS4 Slim Console and two c..
$23.00
Kingdom Hearts 3 decal skin for PS4 Slim Console and two c..
Kingdom Hearts 3 decal skin for PS4 Slim Console and two c..
$23.00
Kingdom Hearts 3 decal skin for PS4 Slim Console and two c..
Kingdom Hearts 3 decal skin for PS4 Slim Console and two c..
$23.00
Kingdom Hearts 3 decal skin for PS4 Slim Console and two c..
Kingdom Hearts 3 decal skin for PS4 Slim Console and two c..
$23.00
Kingdom Hearts 3 decal skin for PS4 Slim Console and two c..
Kingdom Hearts 3 decal skin for PS4 Slim Console and two c..
$23.00
Kingdom Hearts 3 decal skin for PS4 Slim Console and two c..
Kingdom Hearts 3 decal skin for PS4 Slim Console and two c..
$23.00
Kingdom Hearts decal skin for PS4 Slim Console and two con..
Kingdom Hearts decal skin for PS4 Slim Console and two con..
$23.00
Kingdom Hearts decal skin for PS4 Slim Console and two con..
Kingdom Hearts decal skin for PS4 Slim Console and two con..
$23.00
Kingdom Hearts decal skin for PS4 Slim Console and two con..
Kingdom Hearts decal skin for PS4 Slim Console and two con..
$23.00
Kojima Productions decal skin for PS4 Slim Console and two..
Kojima Productions decal skin for PS4 Slim Console and two..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i