Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skin's Store 6
Nice Flowers decal skin for PS4 Slim Console and two contr..
Nice Flowers decal skin for PS4 Slim Console and two contr..
$23.00
Nier automata decal skin for PS4 Slim Console and two cont..
Nier automata decal skin for PS4 Slim Console and two cont..
$23.00
Onimusha decal skin for PS4 Slim Console and two controllers
Onimusha decal skin for PS4 Slim Console and two controllers
$23.00
Onimusha decal skin for PS4 Slim Console and two controllers
Onimusha decal skin for PS4 Slim Console and two controllers
$23.00
Onimusha decal skin for PS4 Slim Console and two controllers
Onimusha decal skin for PS4 Slim Console and two controllers
$23.00
Onimusha decal skin for PS4 Slim Console and two controllers
Onimusha decal skin for PS4 Slim Console and two controllers
$23.00
Onimusha decal skin for PS4 Slim Console and two controllers
Onimusha decal skin for PS4 Slim Console and two controllers
$23.00
Overwatch widowmaker decal skin for PS4 Slim Console and t..
Overwatch widowmaker decal skin for PS4 Slim Console and t..
$23.00
Phoenix Suns decal skin for PS4 Slim Console and two contr..
Phoenix Suns decal skin for PS4 Slim Console and two contr..
$23.00
Pokemon Go decal skin for PS4 Slim Console and two control..
Pokemon Go decal skin for PS4 Slim Console and two control..
$23.00
Pok�mon Go decal skin for PS4 Slim Console and two control..
Pok�mon Go decal skin for PS4 Slim Console and two control..
$23.00
Predator Hunting Grounds decal skin for PS4 Slim Console a..
Predator Hunting Grounds decal skin for PS4 Slim Console a..
$23.00
Predator Hunting Grounds decal skin for PS4 Slim Console a..
Predator Hunting Grounds decal skin for PS4 Slim Console a..
$23.00
Predator Hunting Grounds decal skin for PS4 Slim Console a..
Predator Hunting Grounds decal skin for PS4 Slim Console a..
$23.00
Predator Hunting Grounds decal skin for PS4 Slim Console a..
Predator Hunting Grounds decal skin for PS4 Slim Console a..
$23.00
Predator Hunting Grounds decal skin for PS4 Slim Console a..
Predator Hunting Grounds decal skin for PS4 Slim Console a..
$23.00
Predator Hunting Grounds decal skin for PS4 Slim Console a..
Predator Hunting Grounds decal skin for PS4 Slim Console a..
$23.00
Rainbow Six Siege decal skin for PS4 Slim Console and two ..
Rainbow Six Siege decal skin for PS4 Slim Console and two ..
$23.00
Rainbow Six Siege decal skin for PS4 Slim Console and two ..
Rainbow Six Siege decal skin for PS4 Slim Console and two ..
$23.00
Rainbow Six Siege decal skin for PS4 Slim Console and two ..
Rainbow Six Siege decal skin for PS4 Slim Console and two ..
$23.00
Rainbow Six Siege decal skin for PS4 Slim Console and two ..
Rainbow Six Siege decal skin for PS4 Slim Console and two ..
$23.00
Rainbow Six Siege decal skin for PS4 Slim Console and two ..
Rainbow Six Siege decal skin for PS4 Slim Console and two ..
$23.00
Rainbow Six Siege decal skin for PS4 Slim Console and two ..
Rainbow Six Siege decal skin for PS4 Slim Console and two ..
$23.00
Rainbow Six Siege decal skin for PS4 Slim Console and two ..
Rainbow Six Siege decal skin for PS4 Slim Console and two ..
$23.00
Rainbow Six Siege decal skin for PS4 Slim Console and two ..
Rainbow Six Siege decal skin for PS4 Slim Console and two ..
$23.00
Rainbow Six Siege decal skin for PS4 Slim Console and two ..
Rainbow Six Siege decal skin for PS4 Slim Console and two ..
$23.00
Rainbow Six Siege decal skin for PS4 Slim Console and two ..
Rainbow Six Siege decal skin for PS4 Slim Console and two ..
$23.00
Real Madrid FC decal skin for PS4 Slim Console and two con..
Real Madrid FC decal skin for PS4 Slim Console and two con..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i