Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skin's Store 6
AquaMan decal skin for PS4 Slim Console and two controllers
AquaMan decal skin for PS4 Slim Console and two controllers
$23.00
AquaMan decal skin for PS4 Slim Console and two controllers
AquaMan decal skin for PS4 Slim Console and two controllers
$23.00
AquaMan decal skin for PS4 Slim Console and two controllers
AquaMan decal skin for PS4 Slim Console and two controllers
$23.00
AquaMan decal skin for PS4 Slim Console and two controllers
AquaMan decal skin for PS4 Slim Console and two controllers
$23.00
AquaMan decal skin for PS4 Slim Console and two controllers
AquaMan decal skin for PS4 Slim Console and two controllers
$23.00
AquaMan decal skin for PS4 Slim Console and two controllers
AquaMan decal skin for PS4 Slim Console and two controllers
$23.00
AquaMan decal skin for PS4 Slim Console and two controllers
AquaMan decal skin for PS4 Slim Console and two controllers
$23.00
AquaMan decal skin for PS4 Slim Console and two controllers
AquaMan decal skin for PS4 Slim Console and two controllers
$23.00
Arsenal decal skin for PS4 Slim Console and two controllers
Arsenal decal skin for PS4 Slim Console and two controllers
$23.00
Assassin's Creed decal skin for PS4 Slim Console and two c..
Assassin's Creed decal skin for PS4 Slim Console and two c..
$23.00
Avengers Endgame decal skin for PS4 Slim Console and two c..
Avengers Endgame decal skin for PS4 Slim Console and two c..
$23.00
Avengers Endgame decal skin for PS4 Slim Console and two c..
Avengers Endgame decal skin for PS4 Slim Console and two c..
$23.00
Avengers Endgame decal skin for PS4 Slim Console and two c..
Avengers Endgame decal skin for PS4 Slim Console and two c..
$23.00
Avengers Endgame decal skin for PS4 Slim Console and two c..
Avengers Endgame decal skin for PS4 Slim Console and two c..
$23.00
Avengers Endgame decal skin for PS4 Slim Console and two c..
Avengers Endgame decal skin for PS4 Slim Console and two c..
$23.00
Avengers Endgame decal skin for PS4 Slim Console and two c..
Avengers Endgame decal skin for PS4 Slim Console and two c..
$23.00
Avengers Endgame decal skin for PS4 Slim Console and two c..
Avengers Endgame decal skin for PS4 Slim Console and two c..
$23.00
Avengers Endgame decal skin for PS4 Slim Console and two c..
Avengers Endgame decal skin for PS4 Slim Console and two c..
$23.00
Avengers Endgame decal skin for PS4 Slim Console and two c..
Avengers Endgame decal skin for PS4 Slim Console and two c..
$23.00
Avengers Endgame decal skin for PS4 Slim Console and two c..
Avengers Endgame decal skin for PS4 Slim Console and two c..
$23.00
Avengers Endgame decal skin for PS4 Slim Console and two c..
Avengers Endgame decal skin for PS4 Slim Console and two c..
$23.00
Avengers Endgame decal skin for PS4 Slim Console and two c..
Avengers Endgame decal skin for PS4 Slim Console and two c..
$23.00
Avengers Endgame decal skin for PS4 Slim Console and two c..
Avengers Endgame decal skin for PS4 Slim Console and two c..
$23.00
Avengers Endgame decal skin for PS4 Slim Console and two c..
Avengers Endgame decal skin for PS4 Slim Console and two c..
$23.00
Batman bomb sticker decal skin for PS4 Slim Console and tw..
Batman bomb sticker decal skin for PS4 Slim Console and tw..
$23.00
Batman with Joker decal skin for PS4 Slim Console and two ..
Batman with Joker decal skin for PS4 Slim Console and two ..
$23.00
Bazuhir decal skin for PS4 Slim Console and two controllers
Bazuhir decal skin for PS4 Slim Console and two controllers
$23.00
Bendy and the Ink Machine decal skin for PS4 Slim Console ..
Bendy and the Ink Machine decal skin for PS4 Slim Console ..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i