Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skin's Store 6
Bendy and the Ink Machine decal skin for PS4 Slim Console ..
Bendy and the Ink Machine decal skin for PS4 Slim Console ..
$23.00
Biohazard decal skin for PS4 Slim Console and two controll..
Biohazard decal skin for PS4 Slim Console and two controll..
$23.00
Black Broken Glass decal skin for PS4 Slim Console and two..
Black Broken Glass decal skin for PS4 Slim Console and two..
$23.00
Bloods Drops decal skin for PS4 Slim Console and two contr..
Bloods Drops decal skin for PS4 Slim Console and two contr..
$23.00
Bomb Sticker decal skin for PS4 Slim Console and two contr..
Bomb Sticker decal skin for PS4 Slim Console and two contr..
$23.00
Bomb Sticker decal skin for PS4 Slim Console and two contr..
Bomb Sticker decal skin for PS4 Slim Console and two contr..
$23.00
Bomb Sticker decal skin for PS4 Slim Console and two contr..
Bomb Sticker decal skin for PS4 Slim Console and two contr..
$23.00
Borderlands 2 decal skin for PS4 Slim Console and two cont..
Borderlands 2 decal skin for PS4 Slim Console and two cont..
$23.00
Borderlands 2 decal skin for PS4 Slim Console and two cont..
Borderlands 2 decal skin for PS4 Slim Console and two cont..
$23.00
Borderlands 3 decal skin for PS4 Slim Console and two cont..
Borderlands 3 decal skin for PS4 Slim Console and two cont..
$23.00
Borderlands 3 decal skin for PS4 Slim Console and two cont..
Borderlands 3 decal skin for PS4 Slim Console and two cont..
$23.00
Bullets decal skin for PS4 Slim Console and two controllers
Bullets decal skin for PS4 Slim Console and two controllers
$23.00
Bullets decal skin for PS4 Slim Console and two controllers
Bullets decal skin for PS4 Slim Console and two controllers
$23.00
Call of Duty black ops 4 decal skin for PS4 Slim Console a..
Call of Duty black ops 4 decal skin for PS4 Slim Console a..
$23.00
Call of Duty black ops 4 decal skin for PS4 Slim Console a..
Call of Duty black ops 4 decal skin for PS4 Slim Console a..
$23.00
Call of Duty black ops 4 decal skin for PS4 Slim Console a..
Call of Duty black ops 4 decal skin for PS4 Slim Console a..
$23.00
Call of Duty black ops 4 decal skin for PS4 Slim Console a..
Call of Duty black ops 4 decal skin for PS4 Slim Console a..
$23.00
Call of Duty black ops 4 decal skin for PS4 Slim Console a..
Call of Duty black ops 4 decal skin for PS4 Slim Console a..
$23.00
Call of Duty modern warfare decal skin for PS4 Slim Consol..
Call of Duty modern warfare decal skin for PS4 Slim Consol..
$23.00
Call of Duty modern warfare decal skin for PS4 Slim Consol..
Call of Duty modern warfare decal skin for PS4 Slim Consol..
$23.00
Call of Duty modern warfare decal skin for PS4 Slim Consol..
Call of Duty modern warfare decal skin for PS4 Slim Consol..
$23.00
Camouflage decal skin for PS4 Slim Console and two control..
Camouflage decal skin for PS4 Slim Console and two control..
$23.00
Camouflage decal skin for PS4 Slim Console and two control..
Camouflage decal skin for PS4 Slim Console and two control..
$23.00
Canadian Flag decal skin for PS4 Slim Console and two cont..
Canadian Flag decal skin for PS4 Slim Console and two cont..
$23.00
Carolina Panthers decal skin for PS4 Slim Console and two ..
Carolina Panthers decal skin for PS4 Slim Console and two ..
$23.00
Chelsea FC decal skin for PS4 Slim Console and two control..
Chelsea FC decal skin for PS4 Slim Console and two control..
$23.00
Chicago Bears decal skin for PS4 Slim Console and two cont..
Chicago Bears decal skin for PS4 Slim Console and two cont..
$23.00
Cincinnati Reds decal skin for PS4 Slim Console and two co..
Cincinnati Reds decal skin for PS4 Slim Console and two co..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i