Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skin's Store 6
Judge Eyes decal skin for PS4 Slim Console and two control..
Judge Eyes decal skin for PS4 Slim Console and two control..
$23.00
Judge Eyes decal skin for PS4 Slim Console and two control..
Judge Eyes decal skin for PS4 Slim Console and two control..
$23.00
Judge Eyes decal skin for PS4 Slim Console and two control..
Judge Eyes decal skin for PS4 Slim Console and two control..
$23.00
Judge Eyes decal skin for PS4 Slim Console and two control..
Judge Eyes decal skin for PS4 Slim Console and two control..
$23.00
Judge Eyes decal skin for PS4 Slim Console and two control..
Judge Eyes decal skin for PS4 Slim Console and two control..
$23.00
Hearthstone decal skin for PS4 Slim Console and two contro..
Hearthstone decal skin for PS4 Slim Console and two contro..
$23.00
Hearthstone decal skin for PS4 Slim Console and two contro..
Hearthstone decal skin for PS4 Slim Console and two contro..
$23.00
Grim Reaper decal skin for PS4 Slim Console and two contro..
Grim Reaper decal skin for PS4 Slim Console and two contro..
$23.00
God of War decal skin for PS4 Slim Console and two control..
God of War decal skin for PS4 Slim Console and two control..
$23.00
God of War decal skin for PS4 Slim Console and two control..
God of War decal skin for PS4 Slim Console and two control..
$23.00
God of War decal skin for PS4 Slim Console and two control..
God of War decal skin for PS4 Slim Console and two control..
$23.00
God Eater 3 decal skin for PS4 Slim Console and two contro..
God Eater 3 decal skin for PS4 Slim Console and two contro..
$23.00
God Eater 3 decal skin for PS4 Slim Console and two contro..
God Eater 3 decal skin for PS4 Slim Console and two contro..
$23.00
God Eater 3 decal skin for PS4 Slim Console and two contro..
God Eater 3 decal skin for PS4 Slim Console and two contro..
$23.00
God Eater 3 decal skin for PS4 Slim Console and two contro..
God Eater 3 decal skin for PS4 Slim Console and two contro..
$23.00
God Eater 3 decal skin for PS4 Slim Console and two contro..
God Eater 3 decal skin for PS4 Slim Console and two contro..
$23.00
God Eater 3 decal skin for PS4 Slim Console and two contro..
God Eater 3 decal skin for PS4 Slim Console and two contro..
$23.00
God Eater 3 decal skin for PS4 Slim Console and two contro..
God Eater 3 decal skin for PS4 Slim Console and two contro..
$23.00
God Eater 3 decal skin for PS4 Slim Console and two contro..
God Eater 3 decal skin for PS4 Slim Console and two contro..
$23.00
Ghost rider vs scorpion decal skin for PS4 Slim Console an..
Ghost rider vs scorpion decal skin for PS4 Slim Console an..
$23.00
Ghost Recon breakpoint decal skin for PS4 Slim Console and..
Ghost Recon breakpoint decal skin for PS4 Slim Console and..
$23.00
Ghost Recon breakpoint decal skin for PS4 Slim Console and..
Ghost Recon breakpoint decal skin for PS4 Slim Console and..
$23.00
Ghost Recon breakpoint decal skin for PS4 Slim Console and..
Ghost Recon breakpoint decal skin for PS4 Slim Console and..
$23.00
Ghost Recon breakpoint decal skin for PS4 Slim Console and..
Ghost Recon breakpoint decal skin for PS4 Slim Console and..
$23.00
Ghost Recon breakpoint decal skin for PS4 Slim Console and..
Ghost Recon breakpoint decal skin for PS4 Slim Console and..
$23.00
Ghost Recon breakpoint decal skin for PS4 Slim Console and..
Ghost Recon breakpoint decal skin for PS4 Slim Console and..
$23.00
Germany flag decal skin for PS4 Slim Console and two contr..
Germany flag decal skin for PS4 Slim Console and two contr..
$23.00
Game Pad abstraction decal skin for PS4 Slim Console and t..
Game Pad abstraction decal skin for PS4 Slim Console and t..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i