Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skin's Store 7
Blood Drops decal skin for PS4 Slim Console and two contro..
Blood Drops decal skin for PS4 Slim Console and two contro..
$23.00
Bloodstrained ritual of the night decal skin for PS4 Slim ..
Bloodstrained ritual of the night decal skin for PS4 Slim ..
$23.00
Blue forest decal skin for PS4 Slim Console and two contro..
Blue forest decal skin for PS4 Slim Console and two contro..
$23.00
Bomb Sticker decal skin for PS4 Slim Console and two contr..
Bomb Sticker decal skin for PS4 Slim Console and two contr..
$23.00
Borderlands 3 decal skin for PS4 Slim Console and two cont..
Borderlands 3 decal skin for PS4 Slim Console and two cont..
$23.00
Borderlands 3 decal skin for PS4 Slim Console and two cont..
Borderlands 3 decal skin for PS4 Slim Console and two cont..
$23.00
Borderlands 3 decal skin for PS4 Slim Console and two cont..
Borderlands 3 decal skin for PS4 Slim Console and two cont..
$23.00
Borderlands 3 decal skin for PS4 Slim Console and two cont..
Borderlands 3 decal skin for PS4 Slim Console and two cont..
$23.00
Borderlands 3 decal skin for PS4 Slim Console and two cont..
Borderlands 3 decal skin for PS4 Slim Console and two cont..
$23.00
Borderlands 3 decal skin for PS4 Slim Console and two cont..
Borderlands 3 decal skin for PS4 Slim Console and two cont..
$23.00
Borderlands 3 decal skin for PS4 Slim Console and two cont..
Borderlands 3 decal skin for PS4 Slim Console and two cont..
$23.00
Borderlands 3 decal skin for PS4 Slim Console and two cont..
Borderlands 3 decal skin for PS4 Slim Console and two cont..
$23.00
Borderlands 3 decal skin for PS4 Slim Console and two cont..
Borderlands 3 decal skin for PS4 Slim Console and two cont..
$23.00
Call of Duty black ops 4 decal skin for PS4 Slim Console a..
Call of Duty black ops 4 decal skin for PS4 Slim Console a..
$23.00
Call of Duty black ops decal skin for PS4 Slim Console and..
Call of Duty black ops decal skin for PS4 Slim Console and..
$23.00
Call of Duty modern warfare decal skin for PS4 Slim Consol..
Call of Duty modern warfare decal skin for PS4 Slim Consol..
$23.00
Call of Duty modern warfare decal skin for PS4 Slim Consol..
Call of Duty modern warfare decal skin for PS4 Slim Consol..
$23.00
Call of Duty modern warfare decal skin for PS4 Slim Consol..
Call of Duty modern warfare decal skin for PS4 Slim Consol..
$23.00
Call of Duty modern warfare decal skin for PS4 Slim Consol..
Call of Duty modern warfare decal skin for PS4 Slim Consol..
$23.00
Cinnamoroll decal skin for PS4 Slim Console and two contro..
Cinnamoroll decal skin for PS4 Slim Console and two contro..
$23.00
Cinnamoroll decal skin for PS4 Slim Console and two contro..
Cinnamoroll decal skin for PS4 Slim Console and two contro..
$23.00
Cinnamoroll decal skin for PS4 Slim Console and two contro..
Cinnamoroll decal skin for PS4 Slim Console and two contro..
$23.00
Cinnamoroll decal skin for PS4 Slim Console and two contro..
Cinnamoroll decal skin for PS4 Slim Console and two contro..
$23.00
Cinnamoroll decal skin for PS4 Slim Console and two contro..
Cinnamoroll decal skin for PS4 Slim Console and two contro..
$23.00
Cinnamoroll decal skin for PS4 Slim Console and two contro..
Cinnamoroll decal skin for PS4 Slim Console and two contro..
$23.00
COD Warzone decal skin for PS4 Slim Console and two contro..
COD Warzone decal skin for PS4 Slim Console and two contro..
$23.00
COD Warzone decal skin for PS4 Slim Console and two contro..
COD Warzone decal skin for PS4 Slim Console and two contro..
$23.00
COD Warzone decal skin for PS4 Slim Console and two contro..
COD Warzone decal skin for PS4 Slim Console and two contro..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i