Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skin's Store 7
Reindeer decal skin for PS4 Slim Console and two controllers
Reindeer decal skin for PS4 Slim Console and two controllers
$23.00
Rainbow Six Quarantine decal skin for PS4 Slim Console and..
Rainbow Six Quarantine decal skin for PS4 Slim Console and..
$23.00
Rainbow Six Quarantine decal skin for PS4 Slim Console and..
Rainbow Six Quarantine decal skin for PS4 Slim Console and..
$23.00
Rainbow Six Quarantine decal skin for PS4 Slim Console and..
Rainbow Six Quarantine decal skin for PS4 Slim Console and..
$23.00
Rainbow Six Quarantine decal skin for PS4 Slim Console and..
Rainbow Six Quarantine decal skin for PS4 Slim Console and..
$23.00
Rainbow Six Quarantine decal skin for PS4 Slim Console and..
Rainbow Six Quarantine decal skin for PS4 Slim Console and..
$23.00
PSV Eindhoven FC decal skin for PS4 Slim Console and two c..
PSV Eindhoven FC decal skin for PS4 Slim Console and two c..
$23.00
Pro Evolution Soccer 2020 decal skin for PS4 Slim Console ..
Pro Evolution Soccer 2020 decal skin for PS4 Slim Console ..
$23.00
Pro Evolution Soccer 2020 decal skin for PS4 Slim Console ..
Pro Evolution Soccer 2020 decal skin for PS4 Slim Console ..
$23.00
Pro Evolution Soccer 2020 decal skin for PS4 Slim Console ..
Pro Evolution Soccer 2020 decal skin for PS4 Slim Console ..
$23.00
Pro Evolution Soccer 2020 decal skin for PS4 Slim Console ..
Pro Evolution Soccer 2020 decal skin for PS4 Slim Console ..
$23.00
Pro Evolution Soccer 2020 decal skin for PS4 Slim Console ..
Pro Evolution Soccer 2020 decal skin for PS4 Slim Console ..
$23.00
Pro Evolution Soccer 2020 decal skin for PS4 Slim Console ..
Pro Evolution Soccer 2020 decal skin for PS4 Slim Console ..
$23.00
Pokemon Pikachu decal skin for PS4 Slim Console and two co..
Pokemon Pikachu decal skin for PS4 Slim Console and two co..
$23.00
Pokemon Pikachu decal skin for PS4 Slim Console and two co..
Pokemon Pikachu decal skin for PS4 Slim Console and two co..
$23.00
Pokemon Pikachu decal skin for PS4 Slim Console and two co..
Pokemon Pikachu decal skin for PS4 Slim Console and two co..
$23.00
Pokemon Pikachu decal skin for PS4 Slim Console and two co..
Pokemon Pikachu decal skin for PS4 Slim Console and two co..
$23.00
Pokemon Pikachu decal skin for PS4 Slim Console and two co..
Pokemon Pikachu decal skin for PS4 Slim Console and two co..
$23.00
Pokemon marowak decal skin for PS4 Slim Console and two co..
Pokemon marowak decal skin for PS4 Slim Console and two co..
$23.00
Pokemon Go decal skin for PS4 Slim Console and two control..
Pokemon Go decal skin for PS4 Slim Console and two control..
$23.00
Pokemon Go decal skin for PS4 Slim Console and two control..
Pokemon Go decal skin for PS4 Slim Console and two control..
$23.00
Pokemon Go decal skin for PS4 Slim Console and two control..
Pokemon Go decal skin for PS4 Slim Console and two control..
$23.00
Pokemon Go decal skin for PS4 Slim Console and two control..
Pokemon Go decal skin for PS4 Slim Console and two control..
$23.00
Pokemon evolution decal skin for PS4 Slim Console and two ..
Pokemon evolution decal skin for PS4 Slim Console and two ..
$23.00
Pokemon evolution decal skin for PS4 Slim Console and two ..
Pokemon evolution decal skin for PS4 Slim Console and two ..
$23.00
Pokemon evolution decal skin for PS4 Slim Console and two ..
Pokemon evolution decal skin for PS4 Slim Console and two ..
$23.00
Pittsburgh Pirates decal skin for PS4 Slim Console and two..
Pittsburgh Pirates decal skin for PS4 Slim Console and two..
$23.00
Persona 6 Royal decal skin for PS4 Slim Console and two co..
Persona 6 Royal decal skin for PS4 Slim Console and two co..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i