Product Added to your Cart
x

-------- OR --------

Default
CroatiaFranceHebrewHungaryVietnameseGreeceCzech RepublicDenmarkRomaniaFinland
USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
PS4 Slim Skin's Store 8
500 product(s) found for "PS4 Slim Skin's Store 8"
Joker decal skin for PS4 Sli..
PS4 Slim Skin's Store 8
Joker decal skin for PS4 Sli..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Fortnite decal skin for PS4 ..
PS4 Slim Skin's Store 8
Fortnite decal skin for PS4 ..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Wolf decal skin for PS4 Slim..
PS4 Slim Skin's Store 8
Wolf decal skin for PS4 Slim..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Kimetsu no Yaiba decal skin ..
PS4 Slim Skin's Store 8
Kimetsu no Yaiba decal skin ..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Ghost of Tsushima decal skin..
PS4 Slim Skin's Store 8
Ghost of Tsushima decal skin..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Ghost of Tsushima decal skin..
PS4 Slim Skin's Store 8
Ghost of Tsushima decal skin..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Ghost of Tsushima decal skin..
PS4 Slim Skin's Store 8
Ghost of Tsushima decal skin..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Friday 13 th decal skin for ..
PS4 Slim Skin's Store 8
Friday 13 th decal skin for ..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Supreme decal skin for PS4 S..
PS4 Slim Skin's Store 8
Supreme decal skin for PS4 S..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Superman decal skin for PS4 ..
PS4 Slim Skin's Store 8
Superman decal skin for PS4 ..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Special edition decal skin f..
PS4 Slim Skin's Store 8
Special edition decal skin f..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Evangelion decal skin for PS..
PS4 Slim Skin's Store 8
Evangelion decal skin for PS..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Starry Sky decal skin for PS..
PS4 Slim Skin's Store 8
Starry Sky decal skin for PS..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
GTA 5 decal skin for PS4 Sli..
PS4 Slim Skin's Store 8
GTA 5 decal skin for PS4 Sli..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Hunt Showdown decal skin for..
PS4 Slim Skin's Store 8
Hunt Showdown decal skin for..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Hunt Showdown decal skin for..
PS4 Slim Skin's Store 8
Hunt Showdown decal skin for..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Anime decal skin for PS4 Sli..
PS4 Slim Skin's Store 8
Anime decal skin for PS4 Sli..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Dead by Daylight decal skin ..
PS4 Slim Skin's Store 8
Dead by Daylight decal skin ..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Fortnite decal skin for PS4 ..
PS4 Slim Skin's Store 8
Fortnite decal skin for PS4 ..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Neutral Lightning decal skin..
PS4 Slim Skin's Store 8
Neutral Lightning decal skin..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Among us decal skin for PS4 ..
PS4 Slim Skin's Store 8
Among us decal skin for PS4 ..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Assassins Creed decal skin f..
PS4 Slim Skin's Store 8
Assassins Creed decal skin f..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Cannabis supreme decal skin ..
PS4 Slim Skin's Store 8
Cannabis supreme decal skin ..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
LV brand decal skin for PS4 ..
PS4 Slim Skin's Store 8
LV brand decal skin for PS4 ..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
National flag decal skin for..
PS4 Slim Skin's Store 8
National flag decal skin for..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Cyberpunk 2077 decal skin fo..
PS4 Slim Skin's Store 8
Cyberpunk 2077 decal skin fo..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Tekken 6 decal skin for PS4 ..
PS4 Slim Skin's Store 8
Tekken 6 decal skin for PS4 ..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Fort night decal skin for PS..
PS4 Slim Skin's Store 8
Fort night decal skin for PS..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i