Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skin's Store 8
JD Whisky decal skin for PS4 Slim Console and two controll..
JD Whisky decal skin for PS4 Slim Console and two controll..
$23.00
Joker decal skin for PS4 Slim Console and two controllers
Joker decal skin for PS4 Slim Console and two controllers
$23.00
Joker decal skin for PS4 Slim Console and two controllers
Joker decal skin for PS4 Slim Console and two controllers
$23.00
Joker decal skin for PS4 Slim Console and two controllers
Joker decal skin for PS4 Slim Console and two controllers
$23.00
Juventus decal skin for PS4 Slim Console and two controllers
Juventus decal skin for PS4 Slim Console and two controllers
$23.00
Juventus decal skin for PS4 Slim Console and two controllers
Juventus decal skin for PS4 Slim Console and two controllers
$23.00
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
$23.00
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
$23.00
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
$23.00
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
$23.00
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
$23.00
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
$23.00
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
$23.00
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
$23.00
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
$23.00
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
$23.00
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
$23.00
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
$23.00
Kindom Hearts decal skin for PS4 Slim Console and two cont..
Kindom Hearts decal skin for PS4 Slim Console and two cont..
$23.00
Kobe Bryant decal skin for PS4 Slim Console and two contro..
Kobe Bryant decal skin for PS4 Slim Console and two contro..
$23.00
Kobe Bryant decal skin for PS4 Slim Console and two contro..
Kobe Bryant decal skin for PS4 Slim Console and two contro..
$23.00
Leopard decal skin for PS4 Slim Console and two controllers
Leopard decal skin for PS4 Slim Console and two controllers
$23.00
Leopard print decal skin for PS4 Slim Console and two cont..
Leopard print decal skin for PS4 Slim Console and two cont..
$23.00
Lord of the Rings decal skin for PS4 Slim Console and two ..
Lord of the Rings decal skin for PS4 Slim Console and two ..
$23.00
Los Angeles Dodgers decal skin for PS4 Slim Console and tw..
Los Angeles Dodgers decal skin for PS4 Slim Console and tw..
$23.00
Los Angeles Lakers decal skin for PS4 Slim Console and two..
Los Angeles Lakers decal skin for PS4 Slim Console and two..
$23.00
LV brand decal skin for PS4 Slim Console and two controllers
LV brand decal skin for PS4 Slim Console and two controllers
$23.00
Maccabi Haifa FC decal skin for PS4 Slim Console and two c..
Maccabi Haifa FC decal skin for PS4 Slim Console and two c..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i